KEGG   Acinetobacter baumannii ACICU: ACICU_02953Help
Entry
ACICU_02953       CDS       T00710                                 

Definition
(GenBank) Pyruvate/2-oxoglutarate dehydrogenase complex, dihydrolipoamide dehydrogenase (E3) component
  KO
K00382  dihydrolipoamide dehydrogenase [EC:1.8.1.4]
Organism
abc  Acinetobacter baumannii ACICU
Pathway
abc00010  Glycolysis / Gluconeogenesis
abc00020  Citrate cycle (TCA cycle)
abc00260  Glycine, serine and threonine metabolism
abc00280  Valine, leucine and isoleucine degradation
abc00620  Pyruvate metabolism
abc00630  Glyoxylate and dicarboxylate metabolism
abc00640  Propanoate metabolism
abc01100  Metabolic pathways
abc01110  Biosynthesis of secondary metabolites
abc01120  Microbial metabolism in diverse environments
abc01130  Biosynthesis of antibiotics
abc01200  Carbon metabolism
Module
abc_M00009  Citrate cycle (TCA cycle, Krebs cycle)
abc_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
abc_M00307  Pyruvate oxidation, pyruvate => acetyl-CoA
Brite
KEGG Orthology (KO) [BR:abc00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    ACICU_02953
   00020 Citrate cycle (TCA cycle)
    ACICU_02953
   00620 Pyruvate metabolism
    ACICU_02953
   00630 Glyoxylate and dicarboxylate metabolism
    ACICU_02953
   00640 Propanoate metabolism
    ACICU_02953
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    ACICU_02953
   00280 Valine, leucine and isoleucine degradation
    ACICU_02953
Enzymes [BR:abc01000]
 1. Oxidoreductases
  1.8  Acting on a sulfur group of donors
   1.8.1  With NAD+ or NADP+ as acceptor
    1.8.1.4  dihydrolipoyl dehydrogenase
     ACICU_02953
Exosome [BR:abc04147]
 Exosomal proteins
  Exosomal proteins of breast cancer cells
   ACICU_02953
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Pyr_redox_2 Pyr_redox_dim Pyr_redox GIDA AlaDh_PNT_C FAD_binding_2 NAD_binding_8 FAD_oxidored HI0933_like Pyr_redox_3 3HCDH_N Thi4 2-Hacid_dh_C FAD_binding_3 DAO Lycopene_cycl
Motif
Other DBs
NCBI-ProteinID: ACC58265
Structure
PDB: 

Position
complement(3136378..3137811)
Genome map
AA seq 477 aa AA seqDB search
MSQQFDLVVIGGGPGGYEAAIRAAQLGFKVACIEKRIHNGKPSLGGTCLNVGCIPSKALL
DSSHRYEDTVHHLADHGITTGEVNFDLAKLLARKDKIVDQLTGGIDQLLKGNGIEWLKGT
GKLLAGKKVEFVPHEGETQILEPKYVILASGSVPVNIPVAPVDQDIIVDSTGALNFPEVP
KRLGVIGAGVIGLELGSVWRRLGAEVVVFEAMDAFLPMADKALSKEYQKILTKQGLDIRI
GAKVSGTEVNGREVTVKYTQGGEDKEQTFDKLIVCVGRKAYAEGLLAEDSGIKLTERGLV
EVNDHCATSVEGVYAIGDLVRGPMLAHKAMEEGVMAVERIHGHAAQVNYDTIISVIYTHP
EAAWVGLTEEQAKEKGHEVKTGQFGFAVNGRALAAGEGAGFVKFVADAKTDRLLGMHVIG
PAASDIVHQGMIALEFVSSVEDLQLMTFGHPTFSEVVHEAALAVDGRAIHAIQRKRK
NT seq 1434 nt NT seq  +upstreamnt  +downstreamnt
atgtctcaacaatttgatcttgttgtcattggcggtggtcctggtggttatgaagctgcg
attcgcgctgctcaactaggcttcaaagtcgcttgtattgaaaaacgtattcacaacggt
aagccttctttaggtggtacttgcttaaacgtaggttgtatcccttctaaagctttgctt
gattcttctcatcgttatgaagatacagtgcatcatttagctgatcacggtattacaact
ggtgaagtgaatttcgatcttgcaaaacttcttgctcgtaaagacaaaattgttgaccaa
ttaactggcggtattgatcaattgcttaaaggcaacggtatcgagtggttaaaaggtaca
ggtaaattacttgctggtaaaaaagttgagtttgttccacatgaaggtgaaactcaaatt
ttagaacctaaatacgtaatccttgcgtctggttctgtgcctgtaaatattcctgtagct
cctgtagatcaagatattattgttgattcaactggcgcattaaacttccctgaagtacct
aagcgtttaggtgtaattggtgcaggtgtaatcggtttagaacttggttcagtatggcgt
cgtcttggtgctgaagttgttgtatttgaagcaatggatgcattcttgccaatggctgat
aaagcactttctaaggaatatcaaaaaatcttgactaaacaaggtttagatatccgcatt
ggtgcgaaagtatctggtactgaagtaaacggtcgtgaagtgactgttaaatacactcaa
ggtggcgaagataaagaacaaacgtttgataagttaatcgtttgtgttggccgtaaagct
tatgctgaaggtttattagctgaagattcaggtattaaattaactgagcgtggtttagtt
gaagtaaatgatcactgtgcaacttctgtagaaggtgtatatgcgattggtgacttagta
cgcggtccaatgcttgctcataaagcaatggaagagggcgtaatggctgttgaacgtatt
catggtcatgcagctcaagtaaactatgacacaatcatttctgttatctatacacaccct
gaagcggcgtgggttggtttaactgaagagcaagctaaagaaaaaggtcatgaagtaaaa
actggtcaattcggttttgctgtaaatggtcgtgctttagctgctggtgaaggtgcaggt
tttgttaagtttgttgctgatgcaaaaactgaccgtttattaggtatgcatgtgattggg
cctgcggcatctgatatcgttcaccaaggtatgatcgcacttgaatttgtatcttctgtt
gaagatcttcagttgatgacttttggtcacccaacattctctgaagttgttcatgaagct
gcacttgctgtagatggtcgtgcaattcacgcgattcaacgtaagcgtaaataa

DBGET integrated database retrieval system