KEGG   Acinetobacter baumannii ACICU: ACICU_02961Help
Entry
ACICU_02961       CDS       T00710                                 

Definition
(GenBank) Citrate synthase
  KO
K01647  citrate synthase [EC:2.3.3.1]
Organism
abc  Acinetobacter baumannii ACICU
Pathway
abc00020  Citrate cycle (TCA cycle)
abc00630  Glyoxylate and dicarboxylate metabolism
abc01100  Metabolic pathways
abc01110  Biosynthesis of secondary metabolites
abc01120  Microbial metabolism in diverse environments
abc01130  Biosynthesis of antibiotics
abc01200  Carbon metabolism
abc01210  2-Oxocarboxylic acid metabolism
abc01230  Biosynthesis of amino acids
Module
abc_M00009  Citrate cycle (TCA cycle, Krebs cycle)
abc_M00010  Citrate cycle, first carbon oxidation, oxaloacetate => 2-oxoglutarate
abc_M00012  Glyoxylate cycle
Brite
KEGG Orthology (KO) [BR:abc00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    ACICU_02961
   00630 Glyoxylate and dicarboxylate metabolism
    ACICU_02961
Enzymes [BR:abc01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.3  Acyl groups converted into alkyl groups on transfer
    2.3.3.1  citrate (Si)-synthase
     ACICU_02961
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Citrate_synt
Motif
Other DBs
NCBI-ProteinID: ACC58273
Position
3146775..3148049
Genome map
AA seq 424 aa AA seqDB search
MSEATGKKAVLHLDGKEIELPIYSGTLGPDVIDVKDVLASGHFTFDPGFMATASCESKIT
FIDGDKGILLHRGYPIDQLATQADYLETCYLLLNGELPTAEQKVEFDAKVRAHTMVHDQV
SRFFNGFRRDAHPMAIMVGVVGALSAFYHNNLDIEDINHREITAIRLIAKIPTLAAWSYK
YTVGQPFIYPRNDLNYAENFLHMMFATPADRDYKVNPVLARAMDRIFTLHADHEQNASTS
TVRLAGSTGANPYACISAGISALWGPAHGGANEAVLKMLDEIGSVENVAEFMEKVKRKEV
KLMGFGHRVYKNFDPRAKVMKQTCDEVLEALGINDPQLALAMELERIALNDPYFVERKLY
PNVDFYSGIILKAIGIPTEMFTVIFALARTVGWISHWLEMHSGPYKIGRPRQLYTGEVQR
DIKR
NT seq 1275 nt NT seq  +upstreamnt  +downstreamnt
atgtctgaagcaactggcaaaaaagccgtattacatcttgatggcaaagaaattgaatta
ccaatttacagtggcacattaggtcccgatgtaatcgacgttaaagatgtattggcctca
ggtcactttacttttgatcctggttttatggcgacagcttcatgcgagtctaaaatcaca
tttatcgatggtgacaaaggtattttattacaccgcggttacccgattgaccagttagcg
actcaagcagactaccttgaaacttgttatttattattaaatggcgagttaccaactgct
gaacaaaaagttgagttcgatgcgaaagttcgtgctcatactatggttcatgatcaagtt
agccgtttcttcaatggtttccgtcgtgatgctcaccctatggcaatcatggttggtgta
gtaggcgcattatctgctttctatcacaacaaccttgacattgaagacatcaaccaccgc
gaaattactgcgattcgtttgattgctaaaattccaacgcttgctgcttggagctacaaa
tatactgtaggtcagccattcatctatccacgtaatgacttaaattacgcggaaaacttc
ttacacatgatgtttgcaactcctgcagaccgtgactacaaagtaaaccctgttcttgct
cgtgcaatggatcgtatctttacgcttcatgctgaccacgaacaaaacgcgtctacttct
acagttcgacttgctggttctactggtgcgaacccatatgcgtgtatctctgctggtatc
tctgctctttggggtcctgcacacggtggcgcgaacgaagcagttcttaaaatgcttgat
gaaatcggtagcgttgaaaatgttgctgagttcatggaaaaagttaaacgcaaagaagtt
aaacttatgggcttcggtcaccgcgtttacaaaaacttcgatccacgtgctaaagtgatg
aagcaaacttgtgacgaagttcttgaagcattaggtatcaatgatcctcaattagcgctt
gctatggaacttgaacgtattgcattgaacgacccgtactttgttgaacgtaaactttac
cctaacgtagacttctactctggtatcatccttaaagcgattggtatcccaacagaaatg
tttactgttatcttcgctcttgcacgtacagttggctggatcagtcactggttagaaatg
cacagcggtccttacaaaattggtcgtcctcgtcagctttacactggtgaagtgcaacgt
gacatcaagcgttaa

DBGET integrated database retrieval system