KEGG   Acinetobacter baumannii ACICU: ACICU_02963Help
Entry
ACICU_02963       CDS       T00710                                 

Definition
(GenBank) predicted sulfurtransferase
  KO
K07146  UPF0176 protein
Organism
abc  Acinetobacter baumannii ACICU
Brite
KEGG Orthology (KO) [BR:abc00001]
 09190 Not Included in Pathway or Brite
  09194 Poorly characterized
   99996 General function prediction only
    ACICU_02963
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Rhodanese Rhodanese_C DUF1610
Motif
Other DBs
NCBI-ProteinID: ACC58275
Position
3148717..3149649
Genome map
AA seq 310 aa AA seqDB search
MNATVEQLAPVEQQATAGWVVAALYQFKEVQDPADLQQRLLDLVKTINLCGTLIVAGEGI
NGTVAGDREAIDTIHQFLLNEGFNAMEYKESHSSDKPFRKMKIKLKKEIVTLGVEVKPRD
LVGHYLDPKEWNELIARDDVILIDTRNDYEYKAGTFKGAIDPKTETFREFPEYVKKELEQ
HKDKKIAMFCTGGIRCEKSTSLLLQEGFKEVYHLKGGILKYLEETPPDESLWEGECFVFD
GRTAVTHGVEEGANIKCHACGWPLTPEESALPSYEHGVSCLYCIDKTTEKQKAGFRMRQS
QIAAAKRKRL
NT seq 933 nt NT seq  +upstreamnt  +downstreamnt
atgaacgctactgtagaacagcttgcacctgtagaacagcaagcgaccgcgggttgggtt
gttgcagcactatatcaatttaaagaagttcaagatccagctgatcttcaacaacgtctt
ttagacttagtgaaaacaattaacctttgcggaactctgattgtagcaggtgaaggaatt
aatggtaccgttgctggggaccgtgaggcaattgatacgattcatcaatttttgttaaac
gaaggctttaacgctatggaatataaagaatcccatagttctgacaaacctttccgtaaa
atgaaaattaagcttaaaaaagaaatcgtgactttaggcgttgaagtaaaacctcgtgat
ttagtgggtcactatcttgatcctaaagaatggaatgagcttattgcacgtgatgatgtg
attctaatcgacacacgtaatgactatgaatataaagccggaactttcaagggggcgatt
gacccaaaaacagaaactttccgcgaatttcctgaatatgtaaaaaaagagttagaacaa
cataaagataagaaaatcgcgatgttctgtacgggtggtattcgctgtgaaaaatcaact
tctttgcttcttcaagaaggctttaaagaggtttaccaccttaaaggcggtattcttaaa
tatttagaagaaactcctcctgatgaaagcctttgggaaggtgaatgtttcgtatttgat
ggacgtactgctgtaactcatggtgttgaagaaggtgcaaacattaaatgtcatgcttgt
ggctggcctttaactcctgaagagtctgcgctaccaagctatgaacatggtgtttcttgc
ttgtattgtattgataaaactactgaaaaacaaaaagctggtttccgtatgcgccaatca
caaattgctgccgctaaacgtaaacgtttataa

DBGET integrated database retrieval system