KEGG   Acinetobacter baumannii ACICU: ACICU_02965Help
Entry
ACICU_02965       CDS       T00710                                 

Definition
(GenBank) Transposase and inactivated derivatives, IS30 family
Organism
abc  Acinetobacter baumannii ACICU
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: rve HTH_38 HTH_32 HTH_23 rve_3 HTH_11 HTH_28
Motif
Other DBs
NCBI-ProteinID: ACC58277
Position
complement(3149997..3151007)
Genome map
AA seq 336 aa AA seqDB search
MSYHHLNFEDRTALMLESRKEGFSARKFAELIKRHPSTIYRELKRNSINDVYQAQYASDN
TFARRRRGHRKLKIDSILWKFIVEAIRCLWSPQQIAKRLKTFPDLDQTMNVSHTTIYSTI
RALPKGELKKDLLSCLRHENKKRKANGEPKKDSILQDIKTIHERPAEVQERKIPGHWEAD
LIKGKDNKSSIATLIERNTRLCILATLPDAKAESVRKALTEALKYLPAELRKTLTYDRGR
EMSEHKILEEDLGIDVYFCDPHSPWQKGTCENMNGLIRQYLPKGIDLNQADQHYLNQVAM
SLNTRPRKALDWLTPLEKFAQLVDYHMAFETVAPHV
NT seq 1011 nt NT seq  +upstreamnt  +downstreamnt
ttgtcataccatcatcttaactttgaagatcgtactgcattaatgcttgagtcaagaaaa
gaaggcttttcagccagaaaatttgctgaacttattaaaagacatcctagtacgatctat
cgtgagcttaaaagaaatagcatcaatgacgtttatcaagctcaatatgcttctgataac
acttttgctagacgtagacgtggtcacagaaaactcaaaatcgattcaatcctctggaaa
tttattgttgaagcgatccgttgtttatggtctcctcagcaaatagcaaagcgtttaaag
acatttcctgatttggatcaaacaatgaatgtaagccatacaacgatttattcaacgata
cgagcattacccaagggtgagttgaaaaaagacttattatcctgtctacgtcatgaaaat
aaaaagcgaaaagctaacggtgaacctaaaaaagattctatattacaggatattaaaact
attcatgagcgcccagccgaagttcaagaaagaaaaataccgggtcattgggaagctgat
ttaattaaaggtaaagacaataaaagttcgatagcaacacttattgaacgaaatacacgg
ctctgtatcttggcaacattacctgatgcaaaggcagaatcagtgcgcaaggctttaact
gaagctctgaaatatttacctgcagaactgcgtaaaacgttgacctatgaccgtggacgt
gagatgtcagaacataaaatactcgaagaagatttaggcatagatgtatatttctgtgac
ccacattcaccctggcaaaaaggcacatgcgaaaatatgaatggtttaattaggcaatat
ttacctaaagggattgatttaaatcaggcagatcagcattatttaaatcaagttgccatg
tcactgaatactcgtcctagaaaggcgttagattggcttacaccattagagaaatttgct
cagcttgttgattatcatatggcttttgaaactgtcgcacctcatgtttga

DBGET integrated database retrieval system