KEGG   Acinetobacter baumannii ACICU: ACICU_02968Help
Entry
ACICU_02968       CDS       T00710                                 

Definition
(GenBank) hypothetical protein
Organism
abc  Acinetobacter baumannii ACICU
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DUF3545
Motif
Other DBs
NCBI-ProteinID: ACC58280
Position
complement(3152726..3152932)
Genome map
AA seq 68 aa AA seqDB search
MSSTDFELDDNYGDDDDVGFDESSGKISAKESLEKRRLIDDLLAQRRLERELKDFDYDLD
DDDLDDED
NT seq 207 nt NT seq  +upstreamnt  +downstreamnt
gtgtcttctacagattttgaactagatgataactacggcgatgatgatgatgtcggtttt
gatgagtcatcaggcaaaatcagtgcaaaagaatcgttggaaaaacgtagattaattgat
gatctattggcacagcgccgtttagagcgtgagttaaaagatttcgattatgatttagac
gatgatgatcttgatgacgaagactaa

DBGET integrated database retrieval system