KEGG   Acinetobacter baumannii ACICU: ACICU_02970Help
Entry
ACICU_02970       CDS       T00710                                 

Definition
(GenBank) uncharacterized conserved protein
  KO
K09158  uncharacterized protein
Organism
abc  Acinetobacter baumannii ACICU
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DUF493 RNA_pol_Rbc25
Motif
Other DBs
NCBI-ProteinID: ACC58282
Position
3155275..3155562
Genome map
AA seq 95 aa AA seqDB search
MLDRTPSRELREDLWVFPMDYPIKLIGDAGEELRIAVVDILVKHFPDFDQTTLKVQESRT
GKYHSLTAQLRFDELEQVHALYADLAACPQIRTAL
NT seq 288 nt NT seq  +upstreamnt  +downstreamnt
atgttagaccgcactccatctcgcgaactccgtgaagacctttgggtatttccaatggac
tatccaattaaactcattggcgatgcgggtgaagaattacgtatagctgtcgttgatatt
ctagtgaaacattttcctgactttgaccaaacaacgttaaaagtacaagaatcacgtaca
ggcaaataccattcattaaccgcgcaattacgctttgatgaattggaacaagtgcatgct
ttatatgcagacttggctgcttgtccgcaaataagaactgcgctttaa

DBGET integrated database retrieval system