KEGG   Acinetobacter baumannii ACICU: ACICU_02974Help
Entry
ACICU_02974       CDS       T00710                                 

Definition
(GenBank) Amino acid transporter
Organism
abc  Acinetobacter baumannii ACICU
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: AA_permease AA_permease_2
Motif
Other DBs
NCBI-ProteinID: ACC58286
Position
3158465..3159850
Genome map
AA seq 461 aa AA seqDB search
MTNLSGTKPTAKLQKNLVLWHIIIIGLAYIQPLTLFDTFGLVSERSGGHVPTSYIFALVA
ILLTSISYGHMIKRYPSSGSAYTYAQKSIHPNVGFMVGWSSWLDYLLSPLVNIILADIYL
RALFPEVNNWLWVIGLTALMTVINLFGARFVARFNSTIVVIQLGVIFYFVYQVYILLTQG
VYADGTLNPDKAELWSLTPFWNDMTSISALIGGATVLCFSFTGFDALSSLAEETKDAEKT
LPKAIFSTALLAGIIFIVSTYFIQLYFPSNPNIYFKPLDESQPVMVAAIGSIAFKTLVLY
FAVVAVMASGISAHAGVSRLMYVMGRDGVINKKLFGHISPRLHTPTYNILIVGVVALSAG
FLDLEHIVNLISFGALTAFSFVNFSVISRYALRDGKNKSIKDIINYIIVPTLGFASVFLM
WLEIDKLALQIGLAWAVFGVGYLAYKTKGFKYNAPQHNEHE
NT seq 1386 nt NT seq  +upstreamnt  +downstreamnt
ttgacaaacttatctgggactaaaccaacagctaaacttcaaaagaatcttgtgctttgg
cacatcattattattggtttagcttatattcagccattaactttatttgatacttttggt
ttagtatcagaacgaagtggtggtcatgtacctacttcttatatctttgccttagttgca
attttattgacgtcgatcagttatggacacatgatcaaacgctatccttcttcaggatca
gcatatacctacgcccaaaagtcaattcaccctaatgttggttttatggtgggttggtca
tcttggctagactatttactttcaccactcgtcaatatcattttggccgatatttattta
agagctttgtttccagaagtaaataattggctatgggttattggcttaactgcattaatg
actgtgattaacttatttggcgcacgctttgtcgcgcgttttaacagtacaattgtagtt
attcaacttggtgttattttttactttgtttatcaagtatatattctccttacccaaggc
gtatatgctgatggtacgcttaatcccgataaagccgaattatggtcattaactcctttt
tggaatgatatgacttctattagtgctttgattggtggtgcaacagtactgtgcttttct
tttacaggttttgatgctttatcttcacttgcagaagaaactaaagatgctgaaaaaacg
cttccaaaagcgattttctcaacagcattgcttgcaggtattatttttatcgtaagcact
tactttatccagttgtatttccctagcaatccaaacatctattttaaaccgttagatgaa
tcacaacctgttatggttgcagcaattggcagcattgcatttaaaacattagttttatat
tttgctgtagttgcagtaatggcatccggtatttcagcacatgctggtgtatctcgctta
atgtatgtaatgggtcgtgatggggttattaataaaaagttgtttggtcatattagccca
agattgcatactccgacttacaacattcttattgttggtgtggttgcattatctgctggc
tttttagaccttgaacatattgttaacttaattagtttcggggccttaactgcttttagt
tttgtaaacttctcggtgatttcgcgctacgcgctgagagatggtaaaaacaaatctatc
aaagatattattaattacattattgtaccaacgcttggctttgctagtgtgttcttaatg
tggttagaaattgacaagcttgctttgcaaattggcttagcttgggcagtgtttggggta
ggttatcttgcctataaaaccaaaggctttaaatataatgctcctcaacataatgagcat
gaataa

DBGET integrated database retrieval system