KEGG   Acinetobacter baumannii ACICU: ACICU_02977Help
Entry
ACICU_02977       CDS       T00710                                 

Definition
(GenBank) predicted rRNA methylase (SpoU class)
  KO
K03216  tRNA (cytidine/uridine-2'-O-)-methyltransferase [EC:2.1.1.207]
Organism
abc  Acinetobacter baumannii ACICU
Brite
KEGG Orthology (KO) [BR:abc00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03016 Transfer RNA biogenesis [BR:abc03016]
    ACICU_02977
Enzymes [BR:abc01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.207  tRNA (cytidine34-2'-O)-methyltransferase
     ACICU_02977
Transfer RNA biogenesis [BR:abc03016]
 Prokaryotic Type
  tRNA modification factors
   Methyltransferases
    ACICU_02977
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: SpoU_methylase
Motif
Other DBs
NCBI-ProteinID: ACC58289
Position
complement(3160997..3161470)
Genome map
AA seq 157 aa AA seqDB search
MIHVVLYEPEIPANTGNIIRLCANTGAQLHLVKPLGFELDDKKLKRAGLDYHEWARMQIW
DNIELCLADLKAKGVEHVFPLTTKGSATPHTVDLNRPVALLMGPETRGLPEHVRLMFPQE
QWIRLPMAENSRSLNLSNATAVIVYEAWRQQGFKKLG
NT seq 474 nt NT seq  +upstreamnt  +downstreamnt
gtgattcatgttgttctatacgagcctgagattcctgctaatacaggtaatattattcgt
ctatgcgcgaatacaggcgctcaattgcatttagttaagcctttaggctttgaacttgat
gataaaaagcttaaacgtgcagggcttgattatcatgaatgggcaagaatgcaaatttgg
gacaacatagagctttgtcttgcggacttaaaagcaaaaggtgttgagcatgtttttcct
ttaactacgaaaggttctgctacgcctcatacagttgatttaaatagacctgtggcttta
ttgatggggccagaaacacgcggcttgcctgaacatgttcgtctgatgttccctcaagaa
caatggattcgtttaccaatggcagaaaactcaagaagtttaaacttatctaatgcaact
gccgtaattgtatatgaagcatggcgtcagcaaggctttaaaaaattaggttaa

DBGET integrated database retrieval system