KEGG   Acinetobacter baumannii ACICU: ACICU_02982Help
Entry
ACICU_02982       CDS       T00710                                 

Definition
(GenBank) 50S ribosomal protein L27
  KO
K02899  large subunit ribosomal protein L27
Organism
abc  Acinetobacter baumannii ACICU
Pathway
abc03010  Ribosome
Module
abc_M00178  Ribosome, bacteria
Brite
KEGG Orthology (KO) [BR:abc00001]
 Genetic Information Processing
  Translation
   03010 Ribosome
    ACICU_02982
Ribosome [BR:abc03011]
 Ribosomal Proteins
  Mitochondria/ Chloroplast
   Large subunit
    ACICU_02982
  Bacteria
    ACICU_02982
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Ribosomal_L27 Peptidase_M23
Motif
Other DBs
NCBI-ProteinID: ACC58294
UniProt: B2HXU8
Position
complement(3166230..3166487)
Genome map
AA seq 85 aa AA seqDB search
MATKKAGGSTKNGRDSNPKMLGVKVYGGQTVTAGNIIVRQRGTEFHAGANVGMGRDHTLF
ATADGVVKFEVKGQFGRRYVKVETV
NT seq 258 nt NT seq  +upstreamnt  +downstreamnt
atggcaactaaaaaagccggtggatcgacgaagaacggtcgtgattcaaacccaaaaatg
ttaggtgttaaagtttacggtggtcaaactgtaactgctggtaacatcatcgttcgtcaa
cgtggtactgaattccacgctggtgcaaatgttggtatgggccgtgaccatactttattt
gctactgctgacggcgtagtaaaattcgaagtgaaaggtcaatttggccgtcgctacgta
aaagttgaaactgtttaa

DBGET integrated database retrieval system