KEGG   Acinetobacter baumannii ACICU: ACICU_02990Help
Entry
ACICU_02990       CDS       T00710                                 

Definition
(GenBank) uncharacterized conserved protein
Organism
abc  Acinetobacter baumannii ACICU
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: YbjQ_1 DUF4156 SAM_MT SeleniumBinding
Motif
Other DBs
NCBI-ProteinID: ACC58302
Position
3177152..3177499
Genome map
AA seq 115 aa AA seqDB search
MLLSNLESVPGHQILKQLDVVYGSTVRSKHVGRDLMASLKNIVGGELTGYTELLEESRQE
AMQRMIVKAQQLGANAIVGIRFSTSNIAQGASELFVYGTAVVVQPAPHLPDPFSA
NT seq 348 nt NT seq  +upstreamnt  +downstreamnt
atgttattaagtaatttagaaagtgttccaggccatcaaattttaaagcagcttgatgtc
gtttacgggagtaccgtccgtagtaagcatgtgggtcgcgacttgatggcaagtttaaaa
aatattgtaggtggtgaacttacgggttataccgaattattagaagaatctcgacaagag
gctatgcaacgtatgattgtaaaagcccagcaacttggtgccaatgcaattgttggtatt
cgtttttctacctcaaatattgcccaaggtgcttctgaattatttgtatatggcacagca
gtagttgtgcagccagcacctcatctacccgatccatttagtgcatag

DBGET integrated database retrieval system