KEGG   Acinetobacter baumannii ACICU: ACICU_02996Help
Entry
ACICU_02996       CDS       T00710                                 

Definition
(GenBank) putative tellurite resistance protein-related protein
Organism
abc  Acinetobacter baumannii ACICU
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Methyltransf_25 Methyltransf_11 Methyltransf_23 TehB Methyltransf_31 Methyltransf_12 Methyltransf_5 MTS
Motif
Other DBs
NCBI-ProteinID: ACC58308
Position
complement(3183069..3183653)
Genome map
AA seq 194 aa AA seqDB search
MNEKLIQLSKELKHRPILEKALGYFPNLPLVAIDCGCGAGNESAYLLSKGFNVHAFDISI
DAQKVCTDRFKDDSKFIFYHESFEDFNFPSSSLIIASSSLFFCNPSYFYSVIKRMINALS
EGGILVVDLLGIYDEWVIREPTKFIGFTYQDIADLFLCDFNLLFHKEINENLPLLEGYIK
TWHLHMLILQKSDF
NT seq 585 nt NT seq  +upstreamnt  +downstreamnt
atgaatgaaaaacttattcaattatcaaaagaacttaaacatagacctattttagagaag
gctttaggttattttcctaacttacctttagttgctatcgattgtggctgtggcgctggc
aatgaatctgcttatctactctcaaagggatttaatgttcatgcttttgatatttcaatt
gatgcgcaaaaagtctgtactgatagatttaaagatgactctaaatttattttctatcat
gaatcttttgaagactttaatttcccgtcttcaagcttaattattgcttcatcaagtctg
ttcttttgtaacccaagttatttttatagcgtaattaaacgaatgataaatgctctttct
gaaggtggaattcttgtagttgatttattgggaatttatgatgagtgggttattagagaa
cctacaaaatttataggatttacttatcaagatatagctgatttattcttatgtgatttt
aatctgctgtttcataaagaaattaatgaaaatttacctttattggaaggttatataaaa
acatggcatcttcatatgctgattctacagaaaagtgatttttaa

DBGET integrated database retrieval system