KEGG   Acinetobacter baumannii ACICU: ACICU_03003Help
Entry
ACICU_03003       CDS       T00710                                 

Definition
(GenBank) Response regulator consisting of a CheY-like receiver domain and a winged-helix DNA-binding domain
  KO
K07666  two-component system, OmpR family, response regulator QseB
Organism
abc  Acinetobacter baumannii ACICU
Pathway
abc02020  Two-component system
abc02024  Quorum sensing
Module
abc_M00453  QseC-QseB (quorum sensing) two-component regulatory system
Brite
KEGG Orthology (KO) [BR:abc00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   02020 Two-component system
    ACICU_03003
 09140 Cellular Processes
  09145 Cellular community - prokaryotes
   02024 Quorum sensing
    ACICU_03003
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02022 Two-component system [BR:abc02022]
    ACICU_03003
Two-component system [BR:abc02022]
 OmpR family
  QseC-QseB [MD:M00453]
   ACICU_03003
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Response_reg Trans_reg_C
Motif
Other DBs
NCBI-ProteinID: ACC58315
Position
complement(3190510..3191184)
Genome map
AA seq 224 aa AA seqDB search
MTKILMIEDDFMIAESTITLLQYHQFEVEWVNNGLDGLAQLAKTKFDLILLDLGLPMMDG
MQVLKQIRQRAATPVLIISARDQLQNRVDGLNLGADDYLIKPYEFDELLARIHALLRRSG
VEAQLASQDQLLESGDLVLNVEQHIATFKGQRIDLSNREWAILIPLMTHPNKIFSKANLE
DKLYDFDSDVTSNTIEVYVHHLRAKLGKDFIRTIRGLGYRLGQS
NT seq 675 nt NT seq  +upstreamnt  +downstreamnt
atgacaaaaatcttgatgattgaagatgattttatgattgcagaatcaacgatcacgttg
ctgcaatatcatcaatttgaggtggaatgggtcaataacggtttagatggtttggctcag
ttggcgaagactaaatttgatcttattcttttggatttaggattgcctatgatggatggt
atgcaagttttaaagcagatccgtcaaagagcagcaacaccagtattaattatttctgct
cgagatcaattacaaaaccgtgtcgatggtttaaatttgggtgcagatgattatttaatt
aaaccttatgagtttgatgagttgcttgcccgtattcatgcattactacgccgtagtgga
gtagaagctcaacttgcgagtcaagatcaactattagaaagtggtgatctggttttaaat
gttgaacagcatattgcgacgtttaaaggccaacgcattgatttatcaaatcgtgaatgg
gcaatcttaattccacttatgactcacccaaataaaatcttttctaaagccaacttagaa
gataagttatatgattttgatagtgatgtgaccagtaatactattgaagtatatgttcac
catttaagagcgaagctgggtaaagattttattcgaaccatccgaggactgggctaccgt
ttggggcaatcataa

DBGET integrated database retrieval system