KEGG   Acinetobacter baumannii ACICU: ACICU_03008Help
Entry
ACICU_03008       CDS       T00710                                 

Definition
(GenBank) predicted esterase of the alpha-beta hydrolase superfamily
  KO
K07001  NTE family protein
Organism
abc  Acinetobacter baumannii ACICU
Brite
KEGG Orthology (KO) [BR:abc00001]
 09190 Not Included in Pathway or Brite
  09194 Poorly characterized
   99996 General function prediction only
    ACICU_03008
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Patatin
Motif
Other DBs
NCBI-ProteinID: ACC58320
Position
3196876..3197793
Genome map
AA seq 305 aa AA seqDB search
MKIAQFASIGFISLALFGCDKFSKTPTPTTSVKAREPVIALALGGGGAKGFSHIGVIKVL
ESHGIKPKIVTGTSAGSFVGSIYASGQTPYQLQNLALKLQESDIRDLTLNRQGIILGQKL
QDYVNRNVGNKPIEKFPIRFAAVATRLDNGQKADFIKGNAGQAVRASCSIPNVFVPATIG
KQKYVDGGLVSPIPVKTARDMGADIVIAVDISARPAGNRPANMWGLLDQTINIMGQQSIN
EELKQANVVIQPKVGHLGTLDLKSSNEAILEGEKAAQGQIRQIETAIANFKKSPAAFKPA
PRPKF
NT seq 918 nt NT seq  +upstreamnt  +downstreamnt
atgaaaattgctcaatttgccagtatcggatttatctctttagccctattcggctgtgat
aagttcagcaaaacaccaacaccgaccacttcagttaaagcgcgcgaaccagtgattgca
cttgcattgggtggcggtggagcaaaaggattttcacatattggtgttatcaaggtttta
gaatcacatggtattaaaccgaaaattgttacgggtacaagtgccggtagctttgtaggc
agtatctatgccagtggacaaacgccttatcaactccaaaatcttgcgcttaaattgcaa
gagtctgatattcgcgatttaaccctgaatcgccaaggtattattcttgggcaaaagtta
caggactatgttaaccgtaacgtaggtaacaagcctattgagaaattcccaattcgtttt
gcagcggtagcaacccgtcttgataatggacaaaaagcagactttattaaaggtaatgca
ggacaagctgttcgtgcatcatgcagtattcccaatgtatttgtaccagcaaccattggt
aagcagaaatatgtagatggcggactggttagcccaattccggtcaaaacagcacgtgat
atgggtgctgatattgtgattgcagttgacatttctgcacgtccggcaggaaaccgacct
gcgaatatgtggggattgcttgatcaaactattaatattatgggtcaacaaagtattaat
gaagagttaaagcaagctaacgtggtgattcagcctaaagttgggcacttaggtacactc
gatttaaaatcaagtaatgaagctattttagaaggcgaaaaagctgctcaaggtcaaatt
cgccaaattgaaactgcaattgcaaatttcaaaaaatctccagccgcatttaagcctgcg
ccacgtcctaaattttaa

DBGET integrated database retrieval system