KEGG   Acinetobacter baumannii ACICU: ACICU_03013Help
Entry
ACICU_03013       CDS       T00710                                 

Definition
(GenBank) uncharacterized protein conserved in bacteria
  KO
K09788  2-methylaconitate isomerase [EC:5.3.3.-]
Organism
abc  Acinetobacter baumannii ACICU
Pathway
abc00640  Propanoate metabolism
Brite
KEGG Orthology (KO) [BR:abc00001]
 Metabolism
  Carbohydrate metabolism
   00640 Propanoate metabolism
    ACICU_03013
Enzymes [BR:abc01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.3  Transposing C=C bonds
    5.3.3.-  
     ACICU_03013
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PrpF
Motif
Other DBs
NCBI-ProteinID: ACC58325
Position
complement(3200809..3201996)
Genome map
AA seq 395 aa AA seqDB search
MSFVPQIKIPATYMRGGTSKGVFFKLDDLPEKAQVAGQARDQLLLRVIGSPDPYGKQIDG
MGGATSSTSKTVILAKSTQPDHDVDYLFGQVSIDQAFVDWSGNCGNLTAAVGSFAISNGL
VDADRIPENGLCTVRIWQKNIQKTIIAHVPIINGQVQETGDFELDGVTFPAAEVQIEFLD
PADDGEEGGDMFPTGNVVDQLDVPEIGSFQATFINAGIPTIFLNAEDLGYEGTELQDHIN
GDAAALARFEKIRAYGAVQMGLIKDISEAAARQHTPKIAFVSKPKNYTASSGKNVSENDA
DLLVRALSMGKLHHAMMGTAAVAIGTAAAIPGTLVNLAAGGGEREAVRFGHPSGTLRVGA
QAELTNGQWVVKKAIMSRSARVLMEGWVRVPGDSF
NT seq 1188 nt NT seq  +upstreamnt  +downstreamnt
atgagcttcgtaccgcaaattaaaattccagcaacttacatgcgtggtggaaccagtaaa
ggtgtattctttaaacttgatgatttgccggaaaaagctcaagttgcaggtcaagcaaga
gatcaactcttgctacgtgtcattggtagcccagacccttatggaaaacaaattgatgga
atgggtggagcgacttcgagtaccagtaaaaccgttattctcgccaaaagtacacagcca
gatcatgatgtcgactatttgtttgggcaggtttcaatagatcaagcttttgtagactgg
agtggtaactgcggtaatttaacagcagcggttggttcatttgcaatttcaaatggtttg
gttgatgccgatcgtattcctgaaaatggcctttgtactgttcgaatctggcaaaaaaat
attcaaaaaactattattgcgcatgtacctatcatcaatggccaagttcaagaaaccgga
gactttgaactagatggggtaactttccctgctgctgaagttcaaattgagtttttagac
cctgccgatgatggtgaagagggcggtgatatgttcccgacagggaatgttgttgaccaa
ttagatgttccagagattggtagttttcaagccacatttattaatgccggtattccaacc
attttcttaaatgcagaagatttaggctacgaaggtactgaattacaagatcatattaat
ggtgatgcagcagcattagcacgttttgaaaaaattcgtgcctatggtgcagttcagatg
ggcttaattaaagatatttcagaagcagccgcacgtcagcacacaccaaaaattgctttt
gtctctaaaccaaaaaattacacagcttcaagcggtaaaaacgtttcagagaacgatgcc
gacttactcgttcgagctttgtcgatgggcaaacttcaccatgccatgatgggaacagca
gcggtagcaattggtacagcggctgcgattccaggcactttagtaaatttagcagctggt
ggtggagaacgtgaagcagtacgttttggacatccatctggaacattacgtgttggtgcc
caagctgaacttacaaatggccaatgggtggtgaaaaaagccattatgagtcgtagtgcg
cgtgtgttaatggaaggttgggtacgcgttccgggtgacagtttctaa

DBGET integrated database retrieval system