KEGG   Acinetobacter baumannii ACICU: ACICU_03014Help
Entry
ACICU_03014       CDS       T00710                                 

Definition
(GenBank) Gamma-aminobutyrate permease
  KO
K03293  amino acid transporter, AAT family
Organism
abc  Acinetobacter baumannii ACICU
Brite
KEGG Orthology (KO) [BR:abc00001]
 09190 Not Included in Pathway or Brite
  09193 Unclassified: signaling and cellular processes
   99977 Transport
    ACICU_03014
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: AA_permease AA_permease_2
Motif
Other DBs
NCBI-ProteinID: ACC58326
Position
3202439..3203731
Genome map
AA seq 430 aa AA seqDB search
MGGAIGTGLFLGSAQVIQSAGPSIILGYAIGGLIAFLIMRHLGEMIVEEPVAGSFSHFAY
KYWGKFPGFLAGWNYWMLYVLVAMSELTAVAKYINYWWPHIPAWTSVLFFFVVITAINLT
NVKFYGESEFWLAIIKVAAVISMIVFGLYLLFTADVGSSISFSNLWSHGGFFPNGFSGLF
YMLAFLMFAFGGIELIGMAAAEAKDPKKTIPKAINQVVFRILIFYIGSLAILLSLVPWNQ
LDLGGLDKSPFVMIFSQMGIGWAAHLLNFIILTAALSVYNSGMFANSRMLYGLAQQGNAP
KIFKKVNKQGVPVPAVLLSALLIFGCVLLNYFVPEDALSHLMYIVVGALVLNWAMISMTH
LKFKSAMKKLGQKTHFPALWAPFSNYLVLGFIAVVLYIMWSQGFKESVMMIPIWIVLMFI
LFKVLNAKEQ
NT seq 1293 nt NT seq  +upstreamnt  +downstreamnt
atgggtggagcaattggtaccggattatttttaggctcggcgcaagtgattcaatctgcg
ggaccatccattattttaggatatgccattggtggcttaattgcttttttaattatgcgc
cacctgggagaaatgattgttgaagaacctgttgcaggatcgttcagccattttgcgtat
aaatactgggggaaatttcccggatttttagctggatggaattattggatgctctatgtt
ctggttgcgatgagtgaactcaccgcggtagccaaatatattaattactggtggcctcat
attccagcatggacttctgtcttatttttctttgtcgtgattacggcaattaacctaaca
aacgtcaaattttatggtgagtccgaattctggctcgctattattaaagttgctgcggtt
atctctatgattgtttttggcctttatttgctatttacagcagatgtaggttcaagcatt
tcgtttagtaacctttggtctcatggtggattttttccaaatggctttagtggcctcttc
tatatgttggctttcttgatgttcgcctttggtggtattgaactgattggtatggccgcg
gcagaagcaaaagatccgaaaaaaactattccaaaagcaattaaccaagttgttttccgt
atcttgattttctatatcggttcactagcgatcttactttcattagtgccgtggaaccaa
ttagatcttggcggtctcgacaaaagtccatttgttatgatttttagtcaaatgggtatt
ggttgggctgcacacttactgaactttattattttaaccgccgctctctctgtttataac
agtgggatgtttgcaaatagccgtatgctttacggtttagctcaacaaggcaatgcacca
aaaattttcaagaaagtaaataaacaaggtgtacctgtaccagcagttttgctatcggca
ttactcatttttggctgtgttcttttaaattactttgtaccagaagatgctttaagccac
ttaatgtacattgttgttggagcactggtattgaactgggcgatgatcagtatgactcac
cttaagtttaaatcagcaatgaaaaaactcggtcaaaaaactcactttcctgcactttgg
gcaccgtttagtaactatttggttttaggttttattgctgtagtactctacattatgtgg
agtcaaggctttaaagaatcagtgatgatgattcctatttggatcgttctcatgtttatt
ttgtttaaagtactcaatgccaaagaacagtaa

DBGET integrated database retrieval system