KEGG   Acinetobacter baumannii ACICU: ACICU_03028Help
Entry
ACICU_03028       CDS       T00710                                 

Definition
(GenBank) Ribonuclease G and E
  KO
K08301  ribonuclease G [EC:3.1.26.-]
Organism
abc  Acinetobacter baumannii ACICU
Brite
KEGG Orthology (KO) [BR:abc00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03019 Messenger RNA Biogenesis [BR:abc03019]
    ACICU_03028
   03009 Ribosome biogenesis [BR:abc03009]
    ACICU_03028
Enzymes [BR:abc01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.26  Endoribonucleases producing 5'-phosphomonoesters
    3.1.26.-  
     ACICU_03028
Messenger RNA biogenesis [BR:abc03019]
 Prokaryotic Type
  Bacterial mRNA degradation factors
   RNA degradosome components
    Ribonucreases
     ACICU_03028
Ribosome biogenesis [BR:abc03009]
 Prokaryotic Type
  rRNA processing factors
   ACICU_03028
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: RNase_E_G S1
Motif
Other DBs
NCBI-ProteinID: ACC58340
Position
complement(3217695..3219149)
Genome map
AA seq 484 aa AA seqDB search
MSEELLINVTPMECRVALIENGTVNELYVERTVKRGLVGNIYKGKVVRVLPGMQAAFVDI
GLSRTAFLHINDMVWPRSQPTPNVFELLHPGQILTVQVMKDMLGTKGARLSTDLSIPSRY
LVLMPYGNHIGVSQRIESEEERDRLRNIIESIQAEHNLPGSVIVRTAAEGVDEAEIAQDM
CYLSKLWEYIQRKQVDVAVPSLIFEELPLPQRIIRDLASEETAKIYVDSREIHGKLREFV
DEFVPNMQSRLIHYPGERPLFDLYNVEEDIQKALQTRVALKSGGYLMIDQTEAMTTIDVN
TGSYVGGRSLEDTVFKTNMEATQVIARQLRLRNLGGIIIIDFIDMQEAIHREEVMRQFEK
MLERDHAKTKITQVSELGLVEMTRKRTRESLEHLLCESCPTCQGRGFVKTAETVCYEIFR
EILRYTRAFESTSGFTVVAHPSVIDRLLTAEAPAVADLEHFINRVIKFQVENLYTQEQYD
IILS
NT seq 1455 nt NT seq  +upstreamnt  +downstreamnt
atgtcagaagaactacttattaatgtcacacctatggagtgtcgggtggcattaatcgaa
aatggaactgttaatgagctgtatgttgaacgtacagttaaacgtggacttgtcggcaat
atctacaaaggtaaagttgtacgcgtgcttccgggtatgcaagcggcctttgttgatatc
ggtttatccagaacggcctttttgcatattaatgatatggtttggccacgttcacagcca
actccaaatgtgtttgaactacttcatccagggcagattcttaccgttcaggtgatgaag
gatatgctcggtactaaaggtgctcgcctgagcacagatctttcaattccttctcgctat
ttagttcttatgccatatggtaaccatattggtgtttctcagcgcattgagtctgaagaa
gagcgtgatcggctacgtaatattattgagagcattcaggcggagcataatttacccggt
agcgtaattgttcgtactgctgctgaaggggtagatgaagccgaaattgcacaagatatg
tgctacctcagtaagttatgggaatatattcagcgtaagcaagttgatgtggcagtacct
tccttaatttttgaggaactaccgctaccgcaacgaattatccgtgatctggcaagtgaa
gaaaccgcaaagatttatgtcgattcgagagagattcatggaaaactgcgtgagtttgta
gatgagtttgttccgaatatgcaaagtcgcctgattcattacccgggtgagcgtccatta
tttgatctttacaacgttgaagaagatatccaaaaagcactgcaaacacgtgttgcttta
aagtctggcggttatttaatgattgaccagactgaggcgatgaccacaatagatgtcaat
acaggctcttatgttggtggccgtagccttgaagacactgtctttaagaccaatatggaa
gcgactcaggtgattgcgcgtcagcttagactacgaaatctaggcggcattatcattatt
gattttattgacatgcaagaagcgattcatcgtgaagaagtgatgcgtcaatttgaaaaa
atgcttgaacgtgatcatgccaagaccaaaatcacacaggtttctgaacttggtctggta
gaaatgacacgtaaacgtacacgtgaatcattagaacacttgttatgtgaatcgtgtcca
acgtgtcaggggcgtggttttgtcaaaactgcagagacagtgtgttacgaaatatttcga
gagatattacgctacacccgtgcatttgagtctacgagtggctttactgtcgttgctcat
ccatccgtgattgaccgattattaacagcagaagcacctgcagtggcggatttagagcat
tttatcaacagagttattaaatttcaggtcgaaaatttatatacgcaagagcaatacgat
atcattttaagttaa

DBGET integrated database retrieval system