KEGG   Acinetobacter baumannii ACICU: ACICU_03029Help
Entry
ACICU_03029       CDS       T00710                                 

Definition
(GenBank) Nucleotide-binding protein implicated in inhibition of septum formation
  KO
K06287  septum formation protein
Organism
abc  Acinetobacter baumannii ACICU
Brite
KEGG Orthology (KO) [BR:abc00001]
 09190 Not Included in Pathway or Brite
  09193 Unclassified: signaling and cellular processes
   99978 Cell growth
    ACICU_03029
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Maf
Motif
Other DBs
NCBI-ProteinID: ACC58341
Position
complement(3219263..3219823)
Genome map
AA seq 186 aa AA seqDB search
MAHLVLASSSPRRRELLQQLGLNFEIYSPDIDESVHEGELVHQYVERLAREKAQAVLNIF
PDSVIIAADTSLGLDGQIIGKPDSKQHAFDIWKQLSGRWHDVFSGICIATQQHILSQVVQ
TQVEFASLTTQDMEDYWATGEPVGKAGAYAIQGIASQYIPKIQGSYSNVVGLPLYEFSQL
FKRVKT
NT seq 561 nt NT seq  +upstreamnt  +downstreamnt
atggcgcatttagttttagcttctagttctccgcgtcggagagagttgttgcaacaactg
ggcttaaattttgaaatctatagcccggatattgatgaatctgttcatgaaggtgagctg
gttcaccaatatgtagagcggttagcgagagaaaaagcccaagctgtattaaacattttt
ccagattcagtgattattgcagcagatacgagccttggtctggatggtcagattattggt
aaacctgactcaaagcagcatgcctttgacatctggaaacaattatctggtcgttggcat
gatgtattttccggaatttgtattgcaacacagcaacacatcttaagtcaggtggtgcag
acccaagttgagtttgcatctctaactacgcaagatatggaagattactgggccacagga
gaacctgtagggaaggccggtgcatatgcaattcaaggaattgcttcacaatatattccc
aaaattcaaggaagttatagtaatgtggtagggcttcctttgtacgaattttcacagtta
ttcaaaagagtgaagacataa

DBGET integrated database retrieval system