KEGG   Acinetobacter baumannii ACICU: ACICU_03031Help
Entry
ACICU_03031       CDS       T00710                                 

Definition
(GenBank) Cell shape-determining protein
  KO
K03570  rod shape-determining protein MreC
Organism
abc  Acinetobacter baumannii ACICU
Brite
KEGG Orthology (KO) [BR:abc00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:abc03036]
    ACICU_03031
Chromosome and associated proteins [BR:abc03036]
 Prokaryotic Type
  Chromosome partitioning proteins
   Other chromosome partitioning proteins
    ACICU_03031
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: MreC DUF4537 YajC
Motif
Other DBs
NCBI-ProteinID: ACC58343
Position
complement(3220289..3221146)
Genome map
AA seq 285 aa AA seqDB search
MQPNIFSRQPPSFRSFIIAVITCLVVLFFDWRMPYVIQPARDVLYAAYNPIYALASYPVL
SREWLNQQTKSETQLRRENTAMQAELLQAQVRLQKLSELSAENTRLRGLLDTPLIIDGRM
EIAEVIGTDADPLRHIIIINRGAMDHLKVGQTVLDDKGIMGQIINVYPHSSRVMLLSDKE
HSLSVRLERTGMRAIVSGTGDLGRLKMEYVPTSANIQVGDKVLSSGLGEHFPAGYAVGTV
AKIRRHNSGEFAEIDVTPAAQLATGHHVVVLFSDSLAKEQPYADR
NT seq 858 nt NT seq  +upstreamnt  +downstreamnt
gtgcaaccgaatattttttcaagacagccgccatctttccgctcgttcattattgcggtc
attacatgcttggtggtgctgttctttgattggcgcatgccttatgtaattcagccagca
agggatgtcttgtacgctgcatataatccaatatatgcacttgcaagttatccggtactg
tcgagagaatggctgaatcaacaaactaaatctgaaacacaactgcgccgtgaaaacact
gcaatgcaggctgagctattacaggctcaggtccgcttgcagaagctgtctgaattatct
gctgaaaatacccgcttacgtggtttactcgatacaccattaattattgatggtcgtatg
gaaattgcggaagtgattgggacagatgccgatccacttcgtcacattattattatcaac
cgtggtgcaatggatcatcttaaagttggtcaaacggttttagatgataaagggattatg
gggcaaattatcaatgtatatcctcatagttcacgtgtgatgctgctttctgacaaagag
cattctctatctgttcgtttagagcgtacaggtatgcgtgcaattgtctcgggtactggt
gatttaggccgtttaaaaatggaatatgtgccaacgagtgcaaatattcaggtcggcgat
aaagtattaagttcaggcttaggtgagcattttccagcaggttatgccgtgggtacggtg
gctaaaatccgtcgccataattcaggtgagtttgctgaaattgatgttacaccagcagca
caattagcaactggtcatcatgttgttgtacttttctctgactcattagcgaaggagcaa
ccatatgccgatcgctaa

DBGET integrated database retrieval system