KEGG   Acinetobacter baumannii ACICU: ACICU_03034Help
Entry
ACICU_03034       CDS       T00710                                 

Definition
(GenBank) Asp-tRNAAsn/Glu-tRNAGln amidotransferase A subunit
  KO
K02433  aspartyl-tRNA(Asn)/glutamyl-tRNA(Gln) amidotransferase subunit A [EC:6.3.5.6 6.3.5.7]
Organism
abc  Acinetobacter baumannii ACICU
Pathway
abc00970  Aminoacyl-tRNA biosynthesis
abc01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:abc00001]
 09120 Genetic Information Processing
  09122 Translation
   00970 Aminoacyl-tRNA biosynthesis
    ACICU_03034
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03029 Mitochondrial biogenesis [BR:abc03029]
    ACICU_03034
Enzymes [BR:abc01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.5  Carbon-nitrogen ligases with glutamine as amido-N-donor
    6.3.5.6  asparaginyl-tRNA synthase (glutamine-hydrolysing)
     ACICU_03034
    6.3.5.7  glutaminyl-tRNA synthase (glutamine-hydrolysing)
     ACICU_03034
Mitochondrial biogenesis [BR:abc03029]
 Mitochondrial DNA transcription, translation, and replication factors
  Mitochondrial transcription and translation factors
   Other mitochondrial DNA transcription and translation factors
    ACICU_03034
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Amidase
Motif
Other DBs
NCBI-ProteinID: ACC58346
UniProt: B2HY00
Position
3222705..3224183
Genome map
AA seq 492 aa AA seqDB search
MTDLHRLSIRELAEGLSQAKFSSRELTEHYLKRIAKIDPQVKSYVTVTPEQALREADAAD
AALKAGNATALTGIPLAHKDIFCTKGIKTTAGSKMLDNFISPYDATVVEKTKAAGLVTLG
KVNMDEFAMGSTSESSYVGATSNPWALDHVPGGSSGGSAAAVAADLAPFATGTDTGGSIR
QPASFCGLTGLKPTYGRVSRFGIIAYASSLDQAGPMARSAEDCAYLMNVIAGHDAKDSTS
VKKEVDDYVANLNNTSVKGLRIGIPKQYFNVAGLDADVKARVEESLKKLEEMGAALVEID
LNMTEAYVPTYYLIAPAEASSNLSRYDGVRYGYRCENPADLMDLYKRSRSEGFGPEVQRR
ILIGTYALSAGYYDAYYVKAQKVRRLIQQDFLKAFENVDVIAAPAAPTTAYKIGASLDPV
EMYLGDIYTIAVNLAGLPAINAPVGFDKDNLPVGLQLIGNYWSESQLLSIVHQYQQNTDW
HTKRAAIAEENA
NT seq 1479 nt NT seq  +upstreamnt  +downstreamnt
atgactgatttacatcgcttatcaattcgcgaacttgctgaaggcttaagccaagcgaag
ttttcatctcgcgaattgactgaacattatttaaaacgtattgctaaaatcgatccgcaa
gttaagagctatgtgacggttactccagaacaggcacttcgcgaagccgatgctgccgat
gccgcattaaaagctggcaatgcaactgctttaacgggtattcctcttgcccacaaagac
atcttttgtaccaaaggtattaaaaccactgctggttcaaaaatgctcgataacttcatt
tcaccttacgatgcaaccgttgttgaaaaaactaaagcagctggtctggttactttaggt
aaagtgaacatggatgagtttgcgatgggctcaacttctgagagttcatatgtaggtgca
acgagtaacccttgggcacttgaccatgttcctggcggttcatctggtggttctgctgcg
gctgtagcggctgatttagcaccatttgctacaggtaccgatacaggtggctcaattcgc
caacctgcttctttctgtggtttaacaggcttaaaaccaacttatggtcgtgtatctcgt
ttcgggatcattgcttatgcatcatcattagaccaagcaggtccaatggcacgctctgct
gaagactgtgcttacctgatgaatgtaattgcaggtcacgatgctaaagactcaacttcg
gttaaaaaagaagtcgatgattacgttgcaaacctaaataacacatctgtaaaaggctta
cgcattggtattcctaaacaatactttaacgttgcaggtttagatgcggacgtaaaagca
cgtgttgaagagtctttgaaaaagcttgaagaaatgggcgcagcgcttgttgaaatcgac
ctcaacatgactgaagcttatgtaccaacgtattacctcatcgcgccagcggaagcatct
tctaacttgtcacgttatgacggtgttcgctacggttaccgctgtgaaaacccagctgac
ttgatggatctttacaaacgttcgcgttcagaaggtttcggtccagaagttcaacgccgt
attttaattggtacatacgcgctttctgcgggttattacgatgcttactatgtaaaagca
caaaaagtacgtcgtttaattcaacaagacttcttaaaagcttttgaaaatgtagatgta
attgcagcacctgctgcaccaacaactgcctacaaaattggtgcatctttagaccctgtt
gaaatgtacttaggcgatatctataccatcgcagtgaacttagcaggcttgccagcgatt
aatgctcctgttggttttgataaagacaacttaccagtaggtttacagttaatcggtaat
tactggtcagaatcacaattgttgtcgattgttcaccaataccaacaaaacactgactgg
cacaccaaacgtgcggcaattgctgaggagaatgcataa

DBGET integrated database retrieval system