KEGG   Acinetobacter baumannii ACICU: ACICU_03037Help
Entry
ACICU_03037       CDS       T00710                                 

Definition
(GenBank) putative intracellular protease/amidase
  KO
K05520  protease I [EC:3.5.1.124]
Organism
abc  Acinetobacter baumannii ACICU
Brite
Enzymes [BR:abc01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.1  In linear amides
    3.5.1.124  protein deglycase
     ACICU_03037
Peptidases [BR:abc01002]
 Cysteine Peptidases
  Family C56: PfpI endopeptidase family
   ACICU_03037
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DJ-1_PfpI ThiJ_like GATase
Motif
Other DBs
NCBI-ProteinID: ACC58349
Position
3227296..3227874
Genome map
AA seq 192 aa AA seqDB search
MSKKILMLVGDYAEDYETMVPFQFLTGLGYTVHAVCPNKKNGDHIATAIHDFEGEQTYSE
KRGHNFAINYDFDAVNTEDYVGLVIPGGRAPEYLRMNERVVEIVREFDRVKKPIAAVCHG
AQLLAAADILKDRLCSAYPACAAEVKLAGGQYADIAVTEAVTDGHLVTAPAWPAHPAWLA
QFVKVLGAKISI
NT seq 579 nt NT seq  +upstreamnt  +downstreamnt
atgtctaaaaagattttaatgttggtcggtgactatgcagaagactatgaaactatggtt
cctttccagttcttaactggtttgggttataccgtgcatgcggtttgcccaaataaaaaa
aacggcgatcatattgcgacggctattcatgattttgaaggtgagcaaacttatagcgaa
aaacgtggccacaacttcgcgattaactatgatttcgatgccgttaataccgaagactat
gtaggtttagtcatcccaggtggtcgtgcgccagagtatttacgcatgaatgaacgtgtt
gtcgaaattgtacgtgaattcgatagagtgaaaaaaccaattgcagccgtatgccacggt
gctcagttactcgctgcagcagacattttaaaagaccgcctctgctcggcttatccagca
tgtgcggctgaagtaaaattggcaggtggacaatacgcagatattgctgtgactgaagca
gttacagatggtcatttggtgactgctccagcttggcctgcacatccagcttggttagca
caatttgtgaaagttttaggcgctaagattagtatctaa

DBGET integrated database retrieval system