KEGG   Acinetobacter baumannii ACICU: ACICU_03048Help
Entry
ACICU_03048       CDS       T00710                                 

Definition
(GenBank) Permease of the major facilitator superfamily
  KO
K07552  MFS transporter, DHA1 family, multidrug resistance protein
Organism
abc  Acinetobacter baumannii ACICU
Brite
KEGG Orthology (KO) [BR:abc00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:abc02000]
    ACICU_03048
Transporters [BR:abc02000]
 Major Facilitator Superfamily (MFS)
  Drug transporters
   Drug:H+ antiporter-1 (12 spanner) (DHA1) family [TC:2.A.1.2]
    ACICU_03048
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: MFS_1 Sugar_tr Trp_oprn_chp
Motif
Other DBs
NCBI-ProteinID: ACC58360
Position
complement(3237886..3239100)
Genome map
AA seq 404 aa AA seqDB search
MSEQTAQRQYSIGWIMLLALLTALGPLSIDMYLPALPQMAHDFGVSTQMVANTLPAYFFG
LAIGQLVYGPLSDRIGRKKPLYFGLALYAVASLFCVLATNEWSLIAARILQALGGCVGVV
MARAAIRDRLDVQGSAQAFSSMMIVMGLAPILAPMIGAWILIWFPWQAIFIALSIVGAIC
WLCVHFFFKETLAVDKRLKLSLYQVATLYGAIFKDASFRLPMFAGCLTGAALFCYISSAP
AVFMDQYGLNQQEFAYVFGLNAFGIMLMSSLNKHLTTRVEITKRLKAGSMVQVTGASIVL
IAGLISAAPLWLVMLGLFLAISGIGLTGPNAMALAMSKQGARAGTASAIMGSMQFACGLL
GGVLLNFLIWSASLNMGVMMVLFTLSGFIVVLKAIRQAKSQSLS
NT seq 1215 nt NT seq  +upstreamnt  +downstreamnt
atgtctgaacaaacagcccagcgtcaatattctattggctggattatgttgctcgcttta
ctcacggctttagggccattatccattgatatgtacttacctgcgttgcctcaaatggcc
catgattttggggtgagtacgcaaatggtagcaaacacattaccagcttatttttttggt
ttagccattggacaattggtgtatggacctttaagcgaccgtattggtcgaaaaaagcct
ctttattttgggcttgcgctttatgcagttgcaagcttgttctgtgtgctcgctacaaat
gaatggagtctaattgctgcccgtattttacaagccttaggtggttgtgtgggggtggtt
atggctcgtgctgctatacgagatagattagatgtccaaggctcggcacaagctttttca
agcatgatgatcgtaatgggcttagcacctattttggccccgatgattggggcctggata
ttaatctggtttccgtggcaagcgatttttattgcgctttcaattgtaggggcaatctgt
tggctatgtgtacatttcttttttaaagaaactttggcagttgataagagactcaagtta
tctctatatcaagtggctaccttatatggtgctattttcaaagatgcaagcttccgttta
cctatgtttgcaggatgtttaacaggtgcagcattattctgttatatcagttcagctcca
gccgtttttatggaccaatatggcttaaatcagcaagagtttgcttatgtattcgggctc
aatgcttttggcattatgttaatgtcatctttaaataagcacttaaccacacgtgttgaa
atcactaagcgcttaaaagcaggttcaatggtacaagtgacaggtgcaagcattgtgttg
attgctggcttaatttctgcagcacctttatggctagtaatgttaggactgttcttagca
atttcaggaattggtttaactggaccaaatgctatggctctagccatgtcaaagcaaggt
gctcgtgcaggaacagccagtgcaattatgggcagtatgcaatttgcttgcggtctattg
ggtggagtactgcttaacttccttatttggtctgcatcactcaatatgggagtgatgatg
gtgttatttacattaagtggttttattgttgttttaaaagcgattcgtcaagcaaaaagc
caatcactctcttga

DBGET integrated database retrieval system