KEGG   Acinetobacter baumannii ACICU: ACICU_03049Help
Entry
ACICU_03049       CDS       T00710                                 

Definition
(GenBank) predicted membrane protein
Organism
abc  Acinetobacter baumannii ACICU
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: FUSC-like FUSC_2 FUSC ALMT
Motif
Other DBs
NCBI-ProteinID: ACC58361
Position
3239294..3241402
Genome map
AA seq 702 aa AA seqDB search
MLIAFSGTAFVPYFLGHQLATIPLTLGVVAAGLSDIDDRFSVRIMNLIYTYIGFFITAAS
VQLLFPYPMLFALGLIASCIGWILLGSLGRRYATISYGCLVVSVYTMLGVHLFDQWYIQP
ALLVAGAAWYGLIATISFLLFPVRQLQDKLAASYASLGDFLFAKSNLFDVDMTPASYQQS
MIDLSLENGKLITIFNDLKTALLTRLKGDRGQKGTRRSLHYYFVAQDIHERADSAHIDYQ
KLAKIFQHSDILFRFQRILAIQGKACQELNECILQRKPYIHNKRFKQSFENLRLSLVKLR
NDQQYDLLWVNALFALYRNLKSIDSQLLNLETEQHIQSDKVKQAENQLKDDDLKGWNDIV
VRIKQNLTPESVLFRHAIRVSIVLFIGYVFIQMTHIEYGYWIMLTALFVSQPNFNATKRR
LRLRIVGTLVGIIVGLSIVFLVPSVEGQLVMLILSGVLFFELRSKQYAQATAFITILALI
NFNLDGSAVAAAIPRFVDTLIGCALAWFGVTFIWPDWKFRRLPRSIRRSLQAQCNYLAEV
VKQYHEGHNHALNYRIVRRAAHNTDAEVASLISTLATEPDFDPTRKSDIFEFLCLNHTFL
SYIAALGAHREKIQDQAVLNVLDQALDDIQGALLRDEMPDLTAQNMLQTIRQRLSQNDED
DQKSLIILQQLSLMLSVLNRFSMLKQRLSHDLDNDASELASL
NT seq 2109 nt NT seq  +upstreamnt  +downstreamnt
atgctgattgccttttcaggaactgcgttcgtgccttattttctaggacatcaattagca
acaattcccctcactttaggtgtggtcgcagctggtttaagtgatattgatgatcgcttt
tcagtgcgaatcatgaatttgatttacacctatattggtttcttcattaccgcagcttcc
gtacaattacttttcccttatccaatgctttttgcactagggctgattgcctcttgtatt
ggctggattttactagggtcattaggccgccgttacgcaacaatttcttatggatgtctg
gttgtttcagtttataccatgctgggagttcatttatttgaccagtggtatattcagcca
gctcttttggttgcgggagcagcatggtacggacttattgcaaccattagctttttatta
tttccggttcgccaacttcaagataaacttgcggcctcttatgcttcattaggcgacttt
ctatttgccaaatccaatttgtttgatgtcgatatgactcctgcgagttatcagcaaagc
atgattgatctttcattagaaaatggcaaattaataacgatttttaatgatcttaaaacc
gcccttttaacccgtttaaaaggtgaccgtggacaaaaaggaactcgccgtagcctacat
tattattttgtcgcacaagatattcatgaacgtgcagattctgcccatatcgactatcaa
aagttagctaaaattttccagcacagtgatattttatttaggtttcagcgcattttggca
attcagggtaaagcttgccaagagctaaatgaatgtattttacagcgtaaaccctatatc
cataacaaacgctttaagcagagtttcgagaatttacgcttatctttagtaaagttaaga
aatgatcagcagtatgacttattgtgggtaaatgctctttttgccttataccgaaactta
aagtctattgactcacaattactcaacttagaaacggaacagcatattcagtctgacaaa
gtaaagcaggctgaaaaccaacttaaagatgatgatctaaaaggttggaatgatattgtt
gttcgaataaaacaaaatctaacacctgaatctgtactgttccgtcatgccattcgtgtt
tcgattgttctttttattggatatgtatttattcaaatgactcatatcgaatatggctac
tggattatgttgacagctttatttgttagccaacctaactttaacgcaacaaaacgtcgc
ttacgtttacgtattgtgggtacattagtcggaattattgtcggccttagcatagtattt
ttagtaccttctgtggaagggcaattagtcatgctaattttgagtggcgtactgtttttc
gagttacgtagtaagcaatatgctcaagcaactgcttttattaccattttggcattaatt
aactttaatctggacggttcggcagtcgctgcggctattcctaggtttgttgatacccta
attggttgtgctttagcatggtttggcgtgacctttatttggcctgactggaaattccgt
cgcctaccacgcagtattcgacgctccttacaagcacaatgtaattatttagctgaagtg
gtaaaacaatatcatgaaggacataatcatgccctcaattaccgtattgtccgccgagca
gcacataatactgatgcagaagtcgcttcgcttatttctactttagcaacagagccagac
ttcgaccctactcgtaaatccgatatatttgaatttttatgcctcaatcatacattttta
agttatatcgcagcacttggagcacatcgagaaaagattcaggatcaagcggttcttaac
gtattagatcaagctttagatgatatacaaggtgctttgttaagagatgaaatgcctgat
cttacggcacaaaatatgctacagacgatacgtcagcgcttaagccaaaatgatgaagat
gaccaaaaatcgctcattattttacagcagttatcgttgatgctcagtgtattaaatcga
tttagtatgttaaaacaaaggctaagtcatgatctggataatgatgctagcgaacttgca
tcattataa

DBGET integrated database retrieval system