KEGG   Acinetobacter baumannii ACICU: ACICU_03372Help
Entry
ACICU_03372       CDS       T00710                                 

Definition
(GenBank) Guanylate kinase
  KO
K00942  guanylate kinase [EC:2.7.4.8]
Organism
abc  Acinetobacter baumannii ACICU
Pathway
abc00230  Purine metabolism
abc01100  Metabolic pathways
Module
abc_M00050  Guanine ribonucleotide biosynthesis IMP => GDP,GTP
Brite
KEGG Orthology (KO) [BR:abc00001]
 Metabolism
  Nucleotide metabolism
   00230 Purine metabolism
    ACICU_03372
Enzymes [BR:abc01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.4  Phosphotransferases with a phosphate group as acceptor
    2.7.4.8  guanylate kinase
     ACICU_03372
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Guanylate_kin AAA_18 AAA_16 AAA_33 MobB AAA_22 AAA RsgA_GTPase
Motif
Other DBs
NCBI-ProteinID: ACC58682
Position
3574998..3575627
Genome map
AA seq 209 aa AA seqDB search
MSGLLFVVSAASGTGKTSLVKALLDRVSNLHVSVSHTTRGQRPGELDGVHYHFTTKDEFL
DQVNQGGFIEYAEVFGNYYGTSQATVKQQLAQGHDVLLEIDWQGAEQVRKLFPESKQIFI
LPPTQFDLRQRLSNRGTDSVEVIEHRLSCAVEDMQHYVNFDYIIINDDFNKALHELEAVI
TANRLVLSQQAKRHQNLIQDLITPQPKQE
NT seq 630 nt NT seq  +upstreamnt  +downstreamnt
atgtcgggtctattgtttgtcgtttctgctgcatcaggaacgggcaaaacatctttggtg
aaagccctacttgaccgtgtgagcaatttacatgtttcagtttcgcatactacccgaggt
caacgaccaggtgagttagatggtgttcactatcacttcacaacaaaagatgaattttta
gaccaagtgaaccaaggtggatttatcgaatatgctgaagtatttggtaattactacggc
acttcacaagcaaccgtaaaacaacagttagctcaaggacatgatgtcttgcttgaaatt
gactggcaaggtgcagagcaagtacgcaagctgtttcctgaatctaaacagatctttatt
ttaccacctactcaattcgatttacgtcaacgtttatctaaccgtggtacagactctgtt
gaagttattgaacaccgcttaagctgtgctgttgaagacatgcagcattacgtaaatttc
gactatatcatcattaatgatgactttaataaagccctacatgagcttgaagccgtcatt
acagcaaatcgtttagtcttatctcaacaggcaaaaagacatcaaaatctaattcaagac
ttgattactccacaaccaaaacaggaataa

DBGET integrated database retrieval system