KEGG   Acinetobacter baumannii ACICU: ACICU_p0080Help
Entry
ACICU_p0080       CDS       T00710                                 

Definition
(GenBank) Conserved hypothetical protein
  KO
K12061  conjugal transfer pilus assembly protein TraW
Organism
abc  Acinetobacter baumannii ACICU
Brite
KEGG Orthology (KO) [BR:abc00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02044 Secretion system [BR:abc02044]
    ACICU_p0080
Secretion system [BR:abc02044]
 Type IV secretion system
  Conjugal transfer pilus assembly protein
   ACICU_p0080
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: TraW_N
Motif
Other DBs
NCBI-ProteinID: ACC59056
Position
pACICU2:48777..49415
Genome map
AA seq 212 aa AA seqDB search
MKFSKYLFLLPILAISFNSNSKDLGVNGAVYKIQEPDALEQIYTKLKALEKTGELKRKQQ
EAVSRAMNSAKNPKPVENISTVTVKKVRLFDPTMHLSNDIKTDEGVVVARAGTSVNPLDT
VTMTKTLVLFKGSDPEQVQAVKKLTELYKNRITPILVDGSWFDLTRAWKRQVYFDQYGYI
SKRLQITSVPSIVRQNGKMLEISEVPAKELVK
NT seq 639 nt NT seq  +upstreamnt  +downstreamnt
atgaaattttctaaatatctttttttattaccaattttagcgatttcatttaactctaat
tccaaagatttaggggttaatggagctgtatataaaattcaagagccggatgcattagag
caaatttatacgaaattaaaggctcttgagaaaaccggtgagttaaagcggaaacagcaa
gaagctgtttcacgtgccatgaactctgctaaaaacccaaaaccagttgaaaatatttct
actgttacagtaaagaaggtcaggttatttgacccaaccatgcacttatctaatgacata
aaaactgatgaaggggttgtggttgctagagcaggaacaagtgtaaatccattggatacc
gtgaccatgactaaaacactagttctttttaaaggctcagatccagaacaagtacaagcg
gtaaaaaaattaactgaattgtataaaaatcgaattactccaattttagtagatggctct
tggttcgatttgactagagcttggaaacgtcaagtctactttgaccagtacggttatatc
tcaaagcgattacaaattacatctgtaccatcgattgttagacaaaatggaaaaatgctt
gagattagtgaagtcccagctaaggagttagtgaaatga

DBGET integrated database retrieval system