KEGG   Acinetobacter baumannii ACICU: ACICU_p0085
Entry
ACICU_p0085       CDS       T00710                                 

Definition
(GenBank) Conserved hypothetical protein
  KO
K12057  conjugal transfer pilus assembly protein TraF
Organism
abc  Acinetobacter baumannii ACICU
Brite
KEGG Orthology (KO) [BR:abc00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02044 Secretion system [BR:abc02044]
    ACICU_p0085
Secretion system [BR:abc02044]
 Type IV secretion system
  Conjugal transfer pilus assembly protein
   ACICU_p0085
SSDB
Motif
Pfam: TraF AhpC-TSA Redoxin Thioredoxin_8 Thioredoxin Thioredoxin_2 Glrx-like Glutaredoxin DSBA
Other DBs
NCBI-ProteinID: ACC59061
Position
pACICU2:53250..54038
AA seq 262 aa
MVVFSGLTQLTKANNVLDYDSVWNCDRTKVNWYCNKPKEETPVQEVKKETPKQAPLFDPI
TDLNKLKTATELRAELKKREDIAVMYPTEQNIKNYLDAWHLVQNKATVFTDQWRRVVYQN
PDYDYSLRNPSNNAAIKVQAQAKQTQIDGYLKNLSKEQGLIFFFRSDCPYCHQMAPILKQ
LSQMYGFEVLGVSVDGAGLPDFPNPVDGRAVVQKWGIEKVPATFIASKKTKDHAPIGFGV
MSLNEVIERIWVLTNTQPGQDF
NT seq 789 nt   +upstreamnt  +downstreamnt
atggttgtatttagtgggctaactcagctaacaaaagccaataatgtattggattatgac
tctgtttggaattgtgatcgaactaaagtcaactggtattgtaataagccaaaagaagaa
acgccggttcaggaagtaaaaaaggaaactcctaaacaagctcctttatttgatcctatt
actgatttaaataaattaaagactgcgactgaacttcgagctgagttaaaaaaacgagaa
gatatagcagtcatgtatccgacagaacagaacatcaaaaattatcttgatgcatggcat
cttgtacaaaacaaagcaactgtatttacagaccaatggagacgagtagtttatcagaat
ccagactatgattattcattaagaaacccatctaataatgcagcgattaaagttcaagca
caggcaaagcaaacgcaaattgatggatatcttaagaacttaagtaaagaacaaggattg
atattcttcttcagatcagactgtccgtactgtcatcaaatggctccaatacttaaacaa
ttatcacaaatgtatggttttgaagtgcttggcgttagtgttgatggagctggattacct
gactttccaaatcctgtagatggccgtgcagtggtacaaaaatggggtattgaaaaagta
cccgctacctttattgcatctaaaaaaactaaagatcacgcaccgattggatttggtgta
atgtctttaaatgaagtcatagaaagaatttgggtacttacaaatacccaaccaggtcaa
gatttttaa

DBGET integrated database retrieval system