KEGG   Acinetobacter baumannii TCDC-AB0715: ABTW07_1063Help
Entry
ABTW07_1063       CDS       T01908                                 

Gene name
pit
Definition
(GenBank) phosphate transporter
  KO
K03306  inorganic phosphate transporter, PiT family
Organism
abd  Acinetobacter baumannii TCDC-AB0715
Brite
KEGG Orthology (KO) [BR:abd00001]
 09190 Not Included in Pathway or Brite
  09193 Unclassified: signaling and cellular processes
   99977 Transport
    ABTW07_1063 (pit)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PHO4
Motif
Other DBs
NCBI-ProteinID: ADX91499
Position
1168609..1170144
Genome map
AA seq 511 aa AA seqDB search
MPVFLTIIIATLIYIGFQVSADLAHVPPLSLYSVILLSTALLIALGFEFVNGFHDTANAV
ATVIYTNALPAPVAVMWAGFCNFLGVMVASGAVAYGIIALLPVELIMNMGSGAGFAMVFA
LLIAAILWNLGTWFLGIPASSSHTLIGSILGVGIMNHLLSASTGVTTSGVDMDQVIKVGK
ALLFSPLIGFAFAAIVFLLVKTIFKRQLELFQPPEGNKPPPAIIRAILIFTCTGVSFAHG
SNDGQKGMGLIMLILVGLVPLAYSLNKNLDTQQVQSFHQLSSQTAVLLNQNQPELTDEKA
RAVLTKYIQTKQQTPEVVPALASMTDHLGERVSSYSNLKDIPEAAISEIRNDMYLSTTTF
KRLDKADALPKMDDSQKKLVKDYRSSLDSFLQYIPNWVKVAVALALGLGTMVGWKRIVVT
VGERIGKHHMTYGQGMSAELVAMSTIAAADGLGMPVSTTHVLNSAVAGTMVANKSGLNFN
TVKTILSAWVFTLPATICLSGGLYWLFLQFV
NT seq 1536 nt NT seq  +upstreamnt  +downstreamnt
atgccggtgtttctgacgattattattgcaacacttatttatattgggtttcaggtcagt
gctgatttagcgcatgttccacctttaagcctttattcagttattcttttatctactgca
ctcttgattgcactaggctttgaatttgtaaacggtttccatgacactgctaatgcagtt
gcaacggttatttatacaaatgctttgcctgcaccggttgcagtcatgtgggcaggtttt
tgtaatttccttggggtaatggtcgcaagtggtgctgttgcgtatggcattattgcattg
cttccagttgaacttattatgaacatgggcagtggtgctggctttgcaatggtttttgca
ttgttgatcgctgcaattctttggaatcttggtacttggttcttgggaattcctgcttct
agctctcataccttgattggttcaatcttaggtgtgggtattatgaatcatctgttgagt
gcatcgactggcgtaacgaccagtggtgttgatatggatcaggtgattaaagtaggtaag
gcattattattttctcctttaattggttttgcttttgcggcaattgtattcttgttggtt
aaaactattttcaaacgccaattagaattattccagccacctgaaggaaataagccacca
ccagcaatcattcgcgcaattcttatctttacctgtacaggtgtgagttttgcacatggt
tctaatgatggccaaaaaggtatgggtcttatcatgctgattttggttggtttggtgcca
ttagcttattcattaaataaaaacctcgatacacagcaggttcaatcattccatcagctt
tcttctcaaactgcggttttgttaaaccaaaatcaaccagaattgactgacgaaaaagcg
cgtgcggttttaactaaatacattcaaaccaagcaacaaacgcctgaagttgtgcctgca
ttggcaagcatgactgaccatttgggtgagcgtgtttctagctatagcaacttaaaagat
attccagaagctgcaattagcgaaatccgtaatgacatgtatttgagcacaacgacgttt
aagcgtttggataaggcagatgctttaccaaaaatggatgactcacagaaaaagcttgtg
aaagattatcgtagtagcttggattcattcttacaatacattccaaactgggtgaaagtg
gcggtcgcattagcgcttggacttggtactatggttggctggaaacgtattgtggtaact
gtcggtgagcgtattggtaagcatcacatgacttatggtcaagggatgtctgctgagctt
gttgcaatgagtacaattgctgcagcagatggtttaggtatgccggtttcaacaacacac
gttttaaacagcgctgttgcaggtactatggttgccaataaatcaggcctgaatttcaat
actgtaaaaacaattctctctgcatgggtatttacacttcctgcaaccatctgtttgtcg
ggtggtttgtactggttattcttacagtttgtataa

DBGET integrated database retrieval system