KEGG   Acinetobacter baumannii TCDC-AB0715: ABTW07_1468
Entry
ABTW07_1468       CDS       T01908                                 

Definition
(GenBank) hypothetical protein
  KO
K11901  type VI secretion system protein ImpB
Organism
abd  Acinetobacter baumannii TCDC-AB0715
Brite
KEGG Orthology (KO) [BR:abd00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02044 Secretion system [BR:abd02044]
    ABTW07_1468
Secretion system [BR:abd02044]
 Type VI secretion system
  Imp/Vas secretion system core components
   ABTW07_1468
SSDB
Motif
Pfam: T6SS_VipA DUF29
Other DBs
NCBI-ProteinID: ADX91897
Position
1580403..1580906
AA seq 167 aa
MAKRESVQKKLQRIRPPRVQLTYDVEIGDAKEAKELPFVVGVMGDFSAASELERTKLKDK
KFINVDLDNIDEVMESLSPRAAFQVDNTLTEEGGKMAVDLTFKSMEDFRPENVVQQVDPL
KKLVEARERLTDLRNKISNSERLEDLLDEVLKNTDQIRKLSAEADHE
NT seq 504 nt   +upstreamnt  +downstreamnt
atggctaagagagaaagcgtacaaaagaagcttcagcgaattcgacctcctcgtgttcag
cttacatatgatgtcgaaattggtgatgcgaaagaagcgaaagaactaccattcgttgta
ggtgtaatgggtgatttttcagctgcatctgagcttgagcgtacaaaattaaaagataaa
aaattcattaatgtcgatttagataatattgatgaagtaatggaatctctgtctccaaga
gctgcttttcaagtagacaatacgttgacagaagaaggcggtaaaatggcagttgattta
acgtttaagtcaatggaagattttcgcccggaaaatgttgtacagcaagttgatccatta
aagaaattggttgaggcgcgtgagcgtttaaccgatttaagaaacaaaatttcaaacagt
gagcgtttagaagatctgcttgatgaggttcttaaaaatactgatcaaatccgtaaatta
agtgccgaggccgatcatgaataa

DBGET integrated database retrieval system