KEGG   Acinetobacter baumannii TCDC-AB0715: ABTW07_1470
Entry
ABTW07_1470       CDS       T01908                                 

Definition
(GenBank) hemolysin-coregulated protein (uncharacterized)
  KO
K11903  type VI secretion system secreted protein Hcp
Organism
abd  Acinetobacter baumannii TCDC-AB0715
Pathway
abd03070  Bacterial secretion system
Brite
KEGG Orthology (KO) [BR:abd00001]
 09130 Environmental Information Processing
  09131 Membrane transport
   03070 Bacterial secretion system
    ABTW07_1470
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02044 Secretion system [BR:abd02044]
    ABTW07_1470
Secretion system [BR:abd02044]
 Type VI secretion system
  Imp/Vas secretion system core components
   ABTW07_1470
SSDB
Motif
Pfam: T6SS_HCP DUF3880 FerB
Other DBs
NCBI-ProteinID: ADX91899
Structure
PDB: 
4W64

Position
1582430..1582933
AA seq 167 aa
MKDIYVEFRGKYKVDGESRDSEHKGWLEVNSWSHNIRQPKSATSSSVGGHTAERVEHSDM
VFVKDLDATSPKLWEACSAGYTFDEVQIDFYRANGDKRIKYLQIKLKHVLVSSVTPTVNE
EGVPTEAFGLKYAAVEWTYNQQDINGTAKGAVTKKWSLSNNTASYAA
NT seq 504 nt   +upstreamnt  +downstreamnt
atgaaagatatatacgttgagtttcgcggtaaatataaagttgatggagaatctcgtgat
tctgagcacaaaggttggttagaagttaactcttggtctcataacatccgtcaacctaaa
tctgctacttcaagtagtgtaggcggccacactgctgaacgtgttgaacattctgacatg
gttttcgtgaaagacttagacgcaactagccctaaattatgggaagcttgttcagctggt
tatacatttgatgaagtacaaatcgacttctatcgcgcaaatggcgataaacgtatcaag
tacttacaaatcaaattgaagcacgttttagtttctagtgtgactccaactgttaacgaa
gaaggcgttcctacagaagcattcggtttgaaatatgctgctgttgagtggacttataac
caacaagatattaacggtactgctaaaggtgctgttactaagaaatggtcactttctaat
aatacagcttcttacgcagcgtaa

DBGET integrated database retrieval system