KEGG   Acinetobacter baumannii TCDC-AB0715: ABTW07_1472
Entry
ABTW07_1472       CDS       T01908                                 

Gene name
vasA
Definition
(GenBank) hypothetical protein
  KO
K11896  type VI secretion system protein ImpG
Organism
abd  Acinetobacter baumannii TCDC-AB0715
Brite
KEGG Orthology (KO) [BR:abd00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02044 Secretion system [BR:abd02044]
    ABTW07_1472 (vasA)
Secretion system [BR:abd02044]
 Type VI secretion system
  Imp/Vas secretion system core components
   ABTW07_1472 (vasA)
SSDB
Motif
Pfam: T6SS_TssF
Other DBs
NCBI-ProteinID: ADX91901
Position
1583506..1585317
AA seq 603 aa
MIEELLPFYEKQLQEFGQQSREFAQKYPKIAQRLSLNQEQIDDPHIERLIQAFSLIAARI
DKKLTDSYDVFTRSLFEVMFPQYLRHFPACSVVSFEDINKIKQLTEPHLVPHHTVLKSRS
FKGVQCEFNTTQEVKLLPIHLSGLDFKTTPSAHMHLNQNATLSLKFEIFNNAHACLTDEK
LPIYLDAISNFPLQVLDSIFKKGTSFAVKYGQTIVELSKNPFELIGFAEQESLLPLDQHT
HHAYRLLMEYFCFPEKFSYLKLDLDFLRRLPQHVSEFELLIHFKLNLNDQAVVRNYSELN
IANFKLFTTPVINLFEKYAEPQKIVHKQLEYPLVTDAHHPEFYQVYSILEMNMVREKTNQ
EESYVPVLPFFAMSHYHNDTARFFYSVNYQKLQSNFVEMGYSIISKNLNPFSTRSDFIST
KLLCSNRDLPHEALGQSNNVLNLNDSSLARRAIVLKRPTKPYKFEQGQSEQWRVISHLSL
NSLALMKGDAVSHVKELLALYNLPQSKENYLIIESIKKLEFSLTHKLVDGKPFPMFVRGV
KAELQIDSSVFRGHSLYIFSQLLSRVFNLKVQINSFVDLVVKDYSSQQELYQCSQNVGGK
TLL
NT seq 1812 nt   +upstreamnt  +downstreamnt
gtgatagaagagcttttaccgttttatgaaaaacaattacaagaatttggtcaacaatct
cgagaatttgcccaaaaatatccaaaaattgctcagcgcttatctttaaatcaagagcaa
attgatgacccacatattgaacgtctgattcaggctttttcgctgattgctgctcgaatc
gataaaaaactaacagacagttacgatgtttttactcgttctttatttgaggtgatgttc
cctcaatacttacggcattttcctgcgtgttcagttgttagctttgaagatattaataag
attaaacagcttacagaacctcatcttgtacctcatcatacggttttgaaatctcgtagt
ttcaaaggagtacagtgtgagtttaatacaactcaagaggttaaattactacctattcat
ttaagtggtttagattttaaaactacacctagtgcacatatgcacttaaatcaaaatgcg
acgttgagccttaaatttgaaatttttaataatgctcatgcttgtttaactgatgagaag
cttcctatttatttggatgctatctctaattttcctctacaggtccttgatagtattttc
aaaaaaggaaccagttttgcggttaaatatggacaaacaattgtagaattgagcaagaat
ccatttgaattgattggttttgcagaacaagaaagtttattaccgcttgatcaacatacc
catcatgcttatcgtttgttgatggaatacttttgtttcccggaaaagtttagttatctt
aagctcgatttggattttttaaggcgactacctcagcatgtatccgaatttgagctttta
attcatttcaaattaaacttaaatgatcaagccgttgttagaaactattctgagctaaat
attgcaaactttaaattatttactacccccgtaattaatttatttgaaaaatatgctgaa
ccccagaagatagttcacaagcaattagaatatcctttagttacagacgctcaccatcct
gaattttatcaagtatattcaatacttgagatgaatatggtgcgtgaaaaaacaaatcag
gaagaaagctatgttcctgttttgcctttttttgcgatgagccattaccacaatgataca
gctcgctttttttactcagtaaactatcaaaagttacagtccaatttcgttgaaatgggc
tattcgattatttctaaaaatttaaatccattttcaacgcgctcagattttattagcact
aaattattatgttcaaaccgtgatttacctcatgaagcactgggtcagtctaataacgta
ttaaatttaaatgatagtagcttggcgagacgtgccattgttttaaaacgacctacaaag
ccttataagtttgaacaaggccaaagtgaacagtggcgtgtgatctcgcatctttcatta
aatagcttagcacttatgaaaggggatgctgtttctcatgttaaagagctgctggcttta
tataacttaccgcagtcaaaagaaaactatttaattatagaatcaattaaaaaattagaa
ttttctcttacccataaactcgtagatggcaaaccatttccaatgtttgtaagaggagta
aaagctgaattacaaattgattcatccgtatttagagggcatagcttatatatttttagt
cagttattaagtcgtgtttttaatttaaaggttcaaattaatagttttgttgatttggtg
gttaaggattattcatctcagcaggagttataccaatgcagtcagaacgttggtggcaag
actcttctgtaa

DBGET integrated database retrieval system