KEGG   Acinetobacter baumannii TCDC-AB0715: ABTW07_1473
Entry
ABTW07_1473       CDS       T01908                                 

Definition
(GenBank) hypothetical protein
  KO
K11895  type VI secretion system protein ImpH
Organism
abd  Acinetobacter baumannii TCDC-AB0715
Brite
KEGG Orthology (KO) [BR:abd00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02044 Secretion system [BR:abd02044]
    ABTW07_1473
Secretion system [BR:abd02044]
 Type VI secretion system
  Imp/Vas secretion system core components
   ABTW07_1473
SSDB
Motif
Pfam: T6SS_TssG
Other DBs
NCBI-ProteinID: ADX91902
Position
1585281..1586279
AA seq 332 aa
MQSERWWQDSSVTAELFQRPKSFEFIQATRLLRHMPANDAALSWSDHFKFETSFNLNFPA
TEIESLELVDERVHLTNLIVGLTGIQGALPYTYTNKIKQAPRQQRAETKEFLSLFNHKLT
SQYVESSITYHLPVRYEIENKNDYLDILHALNGYVRSQHQQQDLDEYFAEFSGLMQGQNN
TVHALKTMLSCIFKHEITIKEFVQESFKLAGDQLTTLGGSQPSLLGINTFCGETIQQIDG
KIEIQIGPLKRQQYLKFLPHQELSLKLKKIVETWCSPTLSIDLRLILDETEIQPVRLTQG
QESGLGQGAFLMSRKPNTHNDETCYSLIGEQI
NT seq 999 nt   +upstreamnt  +downstreamnt
atgcagtcagaacgttggtggcaagactcttctgtaacggctgagttgtttcaacgccct
aagtcttttgagtttattcaagcaacacgtttattgcgtcatatgcctgccaatgacgca
gctttatcatggtctgaccattttaaatttgagacctcatttaacttaaactttccagcc
actgaaattgaaagtttagagttagtagatgaacgtgttcatttaacaaacctgatcgtt
ggtctgactggtatacaaggtgcattaccttatacatatacaaataaaattaagcaggct
ccaaggcaacaacgcgctgaaacgaaagagtttttaagcttatttaatcataagctgacc
agtcagtatgtagagtcaagtattacttatcacttgcctgtgcgctatgaaattgaaaat
aaaaatgattatttggatattctccatgcattgaatggttatgttcgctcacaacatcag
caacaagacttggatgaatatttcgctgaattttcaggcctaatgcaggggcaaaataat
acggttcatgctttaaagacgatgttgagttgtatttttaagcatgaaattacaattaaa
gagtttgtacaggaatcgtttaagttagcgggtgatcagctaaccactttaggcggaagt
caaccgagcttacttggtattaacacattttgtggggaaacgattcaacaaattgatgga
aaaattgagattcaaataggtccgcttaagcgtcagcaatatttaaaatttttacctcat
caagagcttagcttaaagctcaaaaaaatcgtagaaacctggtgcagtccaactttatcg
atagatttaagattgatattggatgagactgaaatacaacctgttcgcttaactcaaggc
caagaaagtggtttagggcaaggcgcttttttaatgtctcgtaagcctaatacacataac
gatgaaacatgttatagccttattggagagcaaatatga

DBGET integrated database retrieval system