KEGG   Acinetobacter baumannii TCDC-AB0715: ABTW07_1477
Entry
ABTW07_1477       CDS       T01908                                 

Definition
(GenBank) outer membrane protein
  KO
K03286  OmpA-OmpF porin, OOP family
Organism
abd  Acinetobacter baumannii TCDC-AB0715
Brite
KEGG Orthology (KO) [BR:abd00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:abd02000]
    ABTW07_1477
Transporters [BR:abd02000]
 Other transporters
  Pores ion channels [TC:1]
   ABTW07_1477
SSDB
Motif
Pfam: OmpA BON PTE HTH_45
Other DBs
NCBI-ProteinID: ADX91906
Position
1592543..1593310
AA seq 255 aa
MNQKYQIKLSQLIKGCFIYAIANYALAQPIVVEGVVPNEASKQAILMKMQSVYGADQVVD
KIQVRPVAAPNGWSDSVTRVITPDLKKVSQGKLSVNGTRFELTGKMLNPTEIQPTIQSFQ
SLVQPPYQLFSQLSVNQAEQKIIDDALKNRIIEFESGSAVLTEAGQKILDEMAVALNKVG
GKKVKIVGHTDSSGDATKNLKLSQDRALAVKNYLISKNIPADHLSTEGLGSSKPVADNTS
AEGRKKNRRIEFTVL
NT seq 768 nt   +upstreamnt  +downstreamnt
atgaatcaaaaatatcaaattaaactttcacaacttataaaaggctgttttatatatgca
attgcgaattatgctttagcacagcctatagttgtagaaggtgtagtgccaaatgaagca
agtaaacaggctattttaatgaaaatgcagtctgtttatggtgcagatcaggttgtcgat
aaaatacaagttcgaccagttgccgctccaaatggatggagtgactctgtcacacgagtg
attacacctgatcttaaaaaagtttctcagggtaagttaagtgttaatggaacccgattt
gaactgaccgggaaaatgctaaatccgacagaaatacagccaaccattcagtcttttcag
agtttggtacagcctccatatcaattattttcccagctttctgtaaatcaggctgagcag
aagattattgatgatgctttaaaaaatcgaattattgaatttgaatctggtagtgcagta
ttaactgaagctgggcaaaaaattcttgatgaaatggctgtggctttaaataaagtgggc
gggaaaaaagtcaaaattgtggggcataccgatagttctggtgatgcgaccaaaaactta
aaactcagccaagatcgagctttagcagttaaaaattatttaattagtaagaatattcct
gctgatcatttatctaccgaaggtttaggttcatctaagcctgtagcggacaatacttct
gcggaaggtaggaagaaaaaccgccgaattgagttcaccgttttatag

DBGET integrated database retrieval system