KEGG   Acinetobacter baumannii TCDC-AB0715: ABTW07_1478
Entry
ABTW07_1478       CDS       T01908                                 

Definition
(GenBank) hypothetical protein
Organism
abd  Acinetobacter baumannii TCDC-AB0715
SSDB
Motif
Pfam: PAAR_motif
Other DBs
NCBI-ProteinID: ADX91907
Position
1593327..1593590
AA seq 87 aa
MASPYITIGCPTTGGGQVISGNSAFLIEGIAIACVGDKATCPAHKTVSTIVSGDPNMQVM
GKAAARVNDSLSCGCKLLPKQSLVNQG
NT seq 264 nt   +upstreamnt  +downstreamnt
atggctagcccttacattacgattggatgcccaacgacaggtggagggcaagtcatttct
ggtaatagtgcatttttaattgagggaatcgcaattgcatgtgtaggtgataaagcaact
tgtccggcgcataaaacggtttctacgattgtttccggtgacccaaatatgcaagtgatg
ggaaaagcagcagcaagagtaaatgattcattatcgtgtggctgtaaattattaccgaaa
caaagtttggttaatcaagggtag

DBGET integrated database retrieval system