KEGG   Acinetobacter baumannii TCDC-AB0715: ABTW07_1512Help
Entry
ABTW07_1512       CDS       T01908                                 

Definition
(GenBank) enoyl-CoA hydratase/carnithine racemase
  KO
K01692  enoyl-CoA hydratase [EC:4.2.1.17]
Organism
abd  Acinetobacter baumannii TCDC-AB0715
Pathway
abd00071  Fatty acid degradation
abd00280  Valine, leucine and isoleucine degradation
abd00281  Geraniol degradation
abd00310  Lysine degradation
abd00360  Phenylalanine metabolism
abd00362  Benzoate degradation
abd00380  Tryptophan metabolism
abd00410  beta-Alanine metabolism
abd00627  Aminobenzoate degradation
abd00640  Propanoate metabolism
abd00650  Butanoate metabolism
abd00903  Limonene and pinene degradation
abd00930  Caprolactam degradation
abd01100  Metabolic pathways
abd01110  Biosynthesis of secondary metabolites
abd01120  Microbial metabolism in diverse environments
abd01130  Biosynthesis of antibiotics
abd01212  Fatty acid metabolism
Module
abd_M00087  beta-Oxidation
Brite
KEGG Orthology (KO) [BR:abd00001]
 Metabolism
  Carbohydrate metabolism
   00640 Propanoate metabolism
    ABTW07_1512
   00650 Butanoate metabolism
    ABTW07_1512
  Lipid metabolism
   00071 Fatty acid degradation
    ABTW07_1512
  Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    ABTW07_1512
   00310 Lysine degradation
    ABTW07_1512
   00360 Phenylalanine metabolism
    ABTW07_1512
   00380 Tryptophan metabolism
    ABTW07_1512
  Metabolism of other amino acids
   00410 beta-Alanine metabolism
    ABTW07_1512
  Metabolism of terpenoids and polyketides
   00903 Limonene and pinene degradation
    ABTW07_1512
   00281 Geraniol degradation
    ABTW07_1512
  Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    ABTW07_1512
   00627 Aminobenzoate degradation
    ABTW07_1512
   00930 Caprolactam degradation
    ABTW07_1512
Enzymes [BR:abd01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.17  enoyl-CoA hydratase
     ABTW07_1512
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ECH_1 ECH_2
Motif
Other DBs
NCBI-ProteinID: ADX91941
Position
1630596..1631369
Genome map
AA seq 257 aa AA seqDB search
MQELIKASTAADGVLLLTLNRPEKRNALNNATLQCLCELLEEAEHNAQVKAVVLTGNAQC
FAAGADLSELAAMDAVSLQLDIRPKLWQKIDAFSKPLITAVNGYALGAGFELVLHSDMVI
CGENARFALPEIGLGMLPGAGGTQRLARLVGQQLTMRWAMTGEMISAKQAEQHGICSQVV
PTELTVEYAVQLAAKIAKQAPLAIRVIKQSIKSIHETTLSQGLKFERQNFVWLAATKDRN
EGINAFFEKRKPVFRGE
NT seq 774 nt NT seq  +upstreamnt  +downstreamnt
atgcaagagttgatcaaagccagtacagctgctgacggtgttttgttattaaccctaaac
cgtccagaaaaaagaaatgctttaaacaatgcaacattacagtgtttatgcgagttgctc
gaagaagctgaacataatgctcaagtcaaagcggtggttttaacgggtaacgctcagtgt
tttgcggctggagcagatctgagtgagttggctgcaatggacgccgtgtctttgcaactc
gatattcgcccgaagctttggcaaaaaattgatgcgtttagtaagccactgattacagca
gtgaatggctatgccttaggcgctgggtttgagttggttttgcattcagatatggtgatt
tgcggtgaaaatgcccgattcgctttacctgaaattggccttgggatgttgccgggtgca
ggcggaacacagcgtttagcacgcttggttggacaacaactcaccatgcgctgggctatg
acaggtgaaatgatttcggcaaaacaagccgagcaacatggcatttgcagtcaagtggtt
ccgaccgaattaaccgttgaatatgcggttcaacttgcagccaaaattgccaaacaagcg
cctttagcgattcgcgtgattaaacaatcaattaaaagtattcatgaaacaacattaagt
cagggactcaagtttgaacgtcaaaactttgtctggctggcggctacaaaagatcgaaac
gaagggattaatgctttctttgagaaaagaaagccagtgtttagaggtgagtga

DBGET integrated database retrieval system