KEGG   Acinetobacter baumannii TCDC-AB0715: ABTW07_1953Help
Entry
ABTW07_1953       CDS       T01908                                 

Definition
(GenBank) putative (R,R)-butanediol dehydrogenase
  KO
K00004  (R,R)-butanediol dehydrogenase / meso-butanediol dehydrogenase / diacetyl reductase [EC:1.1.1.4 1.1.1.- 1.1.1.303]
Organism
abd  Acinetobacter baumannii TCDC-AB0715
Pathway
abd00650  Butanoate metabolism
Brite
KEGG Orthology (KO) [BR:abd00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00650 Butanoate metabolism
    ABTW07_1953
Enzymes [BR:abd01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.4  (R,R)-butanediol dehydrogenase
     ABTW07_1953
    1.1.1.303  diacetyl reductase [(R)-acetoin forming]
     ABTW07_1953
    1.1.1.-  
     ABTW07_1953
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ADH_zinc_N ADH_N Glu_dehyd_C ADH_zinc_N_2 Semialdhyde_dh FAD_binding_3 2-Hacid_dh_C TrkA_N
Motif
Other DBs
NCBI-ProteinID: ADX92382
Position
2071922..2072980
Genome map
AA seq 352 aa AA seqDB search
MKAARFYDRGDIRIEDIPEPEVTPGTVGIKVAWCGICGTDLHEFMEGPIFIPPCGHPHPI
SGESAPITMGHEFSGVVYAVGEGVDDIEIGQHVVVEPYIVADDVPTGPGDNYHLSKNMNF
IGLGGRGGGLSEKIAVKRRWVHPISNKIPLDQAALIEPLSVGHHAFVRSGAKAGDIALVG
GAGPIGLLLSAILKAKGLKVIITELSAKRKEKAKESGVADYILDPSEVDVVSEVMKITNG
DGVDVAFECSSVNKVLDTLVAAVKPTGVIVIVSIWSHPASINVHSVVMKELDVRGTIAYV
NDHQETIKLVEEGKINLEPFITQRIQLDDLISQGFETLIHNNESAVKIIVHP
NT seq 1059 nt NT seq  +upstreamnt  +downstreamnt
atgaaagcagcgcgtttttatgacagaggtgatattcgtattgaagatatccctgaacca
gaagtcactcccggcactgtaggcattaaggtagcttggtgtggaatctgtggtacagat
ttgcacgaatttatggaaggaccaatttttattccaccgtgtggacatccgcatcctatt
tcaggcgaatctgcgccgattactatgggacatgagttttcaggtgtggtttatgccgta
ggtgaaggtgtcgatgatattgaaattggtcagcatgtagtcgtagagccttatattgtg
gctgatgatgtgccgactggaccgggcgataattatcatctttccaaaaatatgaacttt
attggtttaggcggtcgtggcggtggcttatcggagaaaattgcggttaaacgccgttgg
gtgcatccaatttccaataaaattccattagatcaagcggccttaattgaaccgttatcg
gtgggtcatcatgctttcgtacgtagtggtgcaaaggccggtgatattgcactggttggc
ggtgcggggccaattggtttattgctttcggcaattttaaaagcgaaagggcttaaggtc
atcattaccgaactaagtgccaaacgtaaagaaaaagccaaagagtcgggagttgcagat
tatattttagacccgtcagaagttgatgttgtttctgaggtcatgaaaattactaatggc
gatggtgttgatgttgcgtttgaatgtagtagcgttaacaaggtgttagatactttggtc
gcggcagtgaaaccaacaggcgttatagttattgtttcgatttggagccacccagcatca
attaatgtgcacagtgtggtaatgaaagagcttgatgtacgcggcacaattgcctatgta
aatgaccatcaggagactattaaactggttgaagaaggtaaaataaatcttgaacctttt
attacgcagcgcattcaacttgatgatttgatttcacaaggttttgaaaccttaattcat
aacaatgagtcagccgttaagattattgtacatccataa

DBGET integrated database retrieval system