KEGG   Acinetobacter baumannii TCDC-AB0715: ABTW07_2096Help
Entry
ABTW07_2096       CDS       T01908                                 

Definition
(GenBank) aldehyde dehydrogenase
  KO
K13877  2,5-dioxopentanoate dehydrogenase [EC:1.2.1.26]
Organism
abd  Acinetobacter baumannii TCDC-AB0715
Pathway
abd00040  Pentose and glucuronate interconversions
abd00053  Ascorbate and aldarate metabolism
abd01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:abd00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00040 Pentose and glucuronate interconversions
    ABTW07_2096
   00053 Ascorbate and aldarate metabolism
    ABTW07_2096
Enzymes [BR:abd01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.1  With NAD+ or NADP+ as acceptor
    1.2.1.26  2,5-dioxovalerate dehydrogenase
     ABTW07_2096
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aldedh Catalase-rel AIRS
Motif
Other DBs
NCBI-ProteinID: ADX92525
Position
2227355..2228839
Genome map
AA seq 494 aa AA seqDB search
MPYEFHHATEQEINQACEAASQAFKTYRHTTPEQRAVFLENIADELDALGTDFLEIVSQE
TALPLARLQGERARTSGQMRLFAKVLRRGDFLGARIDTALPERQPLPRPDLRQIKIGVGP
VAVFGASNFPLAFSTAGGDTASALAAGCSVVVKAHSGHMATADFVAQAIERGVEKSNMPK
GVFNMIYGNGVGEPLVKHPLIQAVGFTGSLRGGRALCDMAAARPQPIPVFAEMSSINPML
MLPEALKNRGDKIAQDLADSVVLGCGQFCTNPGLILGIKSAEFSQLISNLTEIMGAKPAQ
TMLNAGTLKSYTAGLEHLTEHQGIKHLAGQTQQGNQAQPQLFKADVELLLAGDQLLQEEI
FGPTTVIIEVEDKAQLIQALQSMNGQLTATLIADEADLTEFAEVVPVLEEKAGRLLINGY
PTGVEVCDAMVHGGPYPATSDARGTSVGTLAIDRYLRPVCYQNYPQSLLPEALKDSNPLQ
ILRLVNGEMTREAI
NT seq 1485 nt NT seq  +upstreamnt  +downstreamnt
ttgccttatgagtttcaccatgcaaccgagcaagagattaatcaggcctgtgaagcagcc
agtcaagcctttaagacttaccgccataccacacctgaacagcgtgctgtttttttagaa
aatattgcagatgaactcgatgctttgggtaccgattttctagaaattgtctcacaggaa
actgctttgccacttgcacgtttacaaggtgaacgtgcccggaccagtgggcaaatgcgc
ctgtttgctaaagtgctgcgccgtggtgattttttaggtgcccgtattgataccgctttg
cctgagcgccagcctttacctcgcccagacctgcgtcagattaaaatcggtgtaggccct
gttgcagtctttggggcaagtaactttcctttagcattctcaactgcgggtggtgacact
gcttcggcactggcagcaggttgctctgtagtggtgaaagcccatagtggacacatggcc
acagcagactttgtagcgcaggcaattgaacgtggcgtagaaaaatcaaatatgccaaaa
ggtgtgtttaatatgatctacggtaatggcgtgggtgaacctttagtgaagcatccttta
attcaggctgtgggttttaccggttcattgcgtggtggtcgtgctttatgtgatatggcc
gcagcccgtccacaaccgattccagtctttgctgaaatgagcagtattaacccgatgttg
atgttgcccgaagccttaaaaaaccgtggtgacaaaattgcacaggacttggctgattca
gtggttttaggctgtggtcagttctgtaccaatccgggtttaatcttgggtattaaatca
gctgaatttagccagcttattagcaacctgactgaaattatgggggctaagcctgcacag
actatgctcaatgccggcaccttaaaaagttataccgctggtcttgagcacttaaccgag
catcaaggtattaagcatttggcaggtcaaactcaacaaggcaatcaggctcagccacaa
ctgtttaaagctgatgttgagcttttactggcaggtgaccagcttttacaggaagaaatc
tttgggccaaccacagtcatcattgaagttgaagataaagcccaactcattcaggcatta
caaagcatgaatgggcaactgactgcgactttaattgccgatgaggctgacttaaccgag
tttgcagaggtagttcctgtattagaagaaaaagctgggcgattacttataaatggctat
ccaacaggtgttgaggtgtgtgatgccatggtacacggcgggccatacccagccacttca
gatgcacgaggtacttcagttggaaccttggccattgaccgttacttgcgccctgtgtgt
taccagaactatccacagagtctattgccggaagccttaaaagacagcaacccgttgcag
attttaagattggtgaatggtgagatgaccagagaagcgatctaa

DBGET integrated database retrieval system