KEGG   Acinetobacter baumannii TCDC-AB0715: ABTW07_2454Help
Entry
ABTW07_2454       CDS       T01908                                 

Definition
(GenBank) acetyl-CoA acetyltransferase
  KO
K00626  acetyl-CoA C-acetyltransferase [EC:2.3.1.9]
Organism
abd  Acinetobacter baumannii TCDC-AB0715
Pathway
abd00071  Fatty acid degradation
abd00072  Synthesis and degradation of ketone bodies
abd00280  Valine, leucine and isoleucine degradation
abd00310  Lysine degradation
abd00362  Benzoate degradation
abd00380  Tryptophan metabolism
abd00620  Pyruvate metabolism
abd00630  Glyoxylate and dicarboxylate metabolism
abd00640  Propanoate metabolism
abd00650  Butanoate metabolism
abd00900  Terpenoid backbone biosynthesis
abd01100  Metabolic pathways
abd01110  Biosynthesis of secondary metabolites
abd01120  Microbial metabolism in diverse environments
abd01130  Biosynthesis of antibiotics
abd01200  Carbon metabolism
abd01212  Fatty acid metabolism
abd02020  Two-component system
Brite
KEGG Orthology (KO) [BR:abd00001]
 Metabolism
  Carbohydrate metabolism
   00620 Pyruvate metabolism
    ABTW07_2454
   00630 Glyoxylate and dicarboxylate metabolism
    ABTW07_2454
   00640 Propanoate metabolism
    ABTW07_2454
   00650 Butanoate metabolism
    ABTW07_2454
  Lipid metabolism
   00071 Fatty acid degradation
    ABTW07_2454
   00072 Synthesis and degradation of ketone bodies
    ABTW07_2454
  Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    ABTW07_2454
   00310 Lysine degradation
    ABTW07_2454
   00380 Tryptophan metabolism
    ABTW07_2454
  Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    ABTW07_2454
  Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    ABTW07_2454
 Environmental Information Processing
  Signal transduction
   02020 Two-component system
    ABTW07_2454
Enzymes [BR:abd01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.9  acetyl-CoA C-acetyltransferase
     ABTW07_2454
Exosome [BR:abd04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   ABTW07_2454
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Thiolase_N Thiolase_C ketoacyl-synt Macoilin
Motif
Other DBs
NCBI-ProteinID: ADX92878
Position
2600713..2602281
Genome map
AA seq 522 aa AA seqDB search
MSKTTQENPAVENSAQEKVSNTSKSASNTAKHNSTTPKAATNTPKTTRTRSTTAPARSPR
SKSAASATPSTSSNVAAAPKATKTKTSVQQDKTMSQNTVRRVAILGGNRIPFARSNTAYF
KASNSDMLTAALNGLVERFNLQGKRIGEVVAGAVLKHSRDFNMTREVVLSTDLAPETPAY
DIQIACGTGLQAAFVVANKIALGQIDVGIAGGVDTTSDAPIAVGDGLRKVLLELNVAKTG
KDRLKALTKIDFKKLLDAPSNGEPRTGLSMGEHQAITALEWGITREAQDELAASSHQKLA
AAYERGFFDDLMTPFLGLNRDNNLRPDSTVEKLAKLKPVFGKGETATMTAGNSTPLTDGA
SVVLLASEEWAKENGHEVLAYLSFSETAAVDFIGKSGPKEGLLMAPAYAVPRMLKRANLK
LQDFDFYEIHEAFASQVLSTLKAWEDEKFCKERLGLDAPLGSIDRSKLNVNGSSLGAGHP
FAATGGRILATAAKLINEKGSGRALISICTAGGEGVVAIVEK
NT seq 1569 nt NT seq  +upstreamnt  +downstreamnt
atgagcaaaacaactcaagaaaatccagcagtcgagaattctgctcaggaaaaagtgtca
aatacatcaaagtcggcttctaacacggctaagcataacagcactactcctaaagcagca
actaatacaccaaaaacgacacgtactcgttcaacgactgcacctgcacgtagccctcgt
agtaagagcgctgcttcagcaaccccgtctacatcttcaaatgtagctgcagcaccaaaa
gcaacaaaaaccaaaacttctgttcaacaggataaaaccatgagtcaaaacactgttcgc
cgcgttgcaatccttggtggcaaccgtattccatttgcacgttcaaatactgcctacttt
aaagcgtctaattctgacatgctgacagcagcattgaatggtttggttgagcgctttaac
ttacaaggtaaacgtattggcgaagttgttgcgggcgctgttttaaaacatagccgtgac
ttcaacatgactcgtgaagttgtattgagcacagatcttgctcctgaaactcctgcttac
gacatccaaattgcatgtggtacaggtttacaagcagcatttgttgttgctaacaaaatt
gcgcttggtcaaatcgacgtaggtattgcaggtggcgtagatacaacttctgacgcaccg
attgctgtaggtgatggtttacgtaaagttttacttgagcttaatgttgctaaaacaggt
aaagaccgtcttaaagctctaacaaagattgattttaaaaagcttcttgatgcaccaagc
aatggtgaaccacgtactggcctttcaatgggtgagcaccaagcaatcactgcattagaa
tggggtatcactcgtgaagcacaagacgagctagctgcaagcagccatcaaaaacttgct
gctgcttatgagcgtggtttttttgatgacttaatgactccattcttaggtcttaaccgt
gacaacaacttacgtcctgacagtacagttgaaaaacttgctaagttaaaaccagttttc
ggtaaaggcgaaactgcaacaatgacagcgggtaactcaactccgttgactgatggtgct
tctgtggtattgcttgcttctgaagaatgggcaaaagaaaacggacatgaagttttagct
tatctttctttctctgaaacagcagctgttgacttcattggtaagagcgggcctaaagaa
ggcttattgatggctcctgcttatgcagtacctcgtatgcttaagcgtgctaaccttaag
cttcaagacttcgatttctacgaaatccatgaagcatttgcatctcaagtactctctacc
ttaaaagcttgggaagatgaaaaattctgtaaagaacgtcttggcttagatgcaccattg
ggttcaattgaccgctctaaactgaacgtaaatggttcatctttaggtgcaggtcaccca
tttgctgcaactggtggtcgtatcttggctactgcagctaaattaattaatgaaaaaggt
tcaggccgcgcattaatctcgatctgtacagcaggcggtgaaggtgtggttgcgattgta
gaaaaataa

DBGET integrated database retrieval system