KEGG   Acinetobacter baumannii TCDC-AB0715: ABTW07_3181Help
Entry
ABTW07_3181       CDS       T01908                                 

Gene name
sdhD
Definition
(GenBank) succinate dehydrogenase, hydrophobic anchor subunit
  KO
K00242  succinate dehydrogenase / fumarate reductase, membrane anchor subunit
Organism
abd  Acinetobacter baumannii TCDC-AB0715
Pathway
abd00020  Citrate cycle (TCA cycle)
abd00190  Oxidative phosphorylation
abd00650  Butanoate metabolism
abd01100  Metabolic pathways
abd01110  Biosynthesis of secondary metabolites
abd01120  Microbial metabolism in diverse environments
abd01130  Biosynthesis of antibiotics
abd01200  Carbon metabolism
Module
abd_M00009  Citrate cycle (TCA cycle, Krebs cycle)
abd_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
abd_M00149  Succinate dehydrogenase, prokaryotes
Brite
KEGG Orthology (KO) [BR:abd00001]
 Metabolism
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    ABTW07_3181 (sdhD)
   00650 Butanoate metabolism
    ABTW07_3181 (sdhD)
  Energy metabolism
   00190 Oxidative phosphorylation
    ABTW07_3181 (sdhD)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Sdh_cyt CybS
Motif
Other DBs
NCBI-ProteinID: ADX93601
Position
complement(3399979..3400344)
Genome map
AA seq 121 aa AA seqDB search
MKSATGLTGSGSRDWFIQRVSAVVLAAYTVVLFGWILCKGGFDYQQWAGFMMTLPMKIFS
LLAILSLIAHAWIGMWQVFTDYVTTRQMGPSAKGLRLVLTTAVIIAVFVYAIWGIQIFWA
N
NT seq 366 nt NT seq  +upstreamnt  +downstreamnt
atgaaaagtgctacaggtttaacaggttcaggttctcgtgattggtttatccagcgtgta
agtgctgtggtattggcagcttatactgttgttctttttggttggatcctctgcaaaggc
ggatttgactatcaacaatgggctggcttcatgatgacattaccaatgaagattttctct
ttattggcaattttgtcgcttatcgcacacgcatggattggtatgtggcaggtttttact
gactatgtcactactcgtcaaatgggtccttcagcgaaaggtttacgccttgtactgact
acggctgtcattattgcagtgtttgtgtacgcaatctggggtatccagattttctgggcg
aattga

DBGET integrated database retrieval system