KEGG   Acinetobacter baumannii TCDC-AB0715: ABTW07_3694Help
Entry
ABTW07_3694       CDS       T01908                                 

Definition
(GenBank) putative transcription activator
  KO
K03707  thiaminase (transcriptional activator TenA) [EC:3.5.99.2]
Organism
abd  Acinetobacter baumannii TCDC-AB0715
Pathway
abd00730  Thiamine metabolism
abd01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:abd00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00730 Thiamine metabolism
    ABTW07_3694
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:abd03000]
    ABTW07_3694
Enzymes [BR:abd01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.99  In other compounds
    3.5.99.2  aminopyrimidine aminohydrolase
     ABTW07_3694
Transcription factors [BR:abd03000]
 Prokaryotic type
  Other transcription factors
   Others
    ABTW07_3694
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: TENA_THI-4 VHP
Motif
Other DBs
NCBI-ProteinID: ADX94111
Position
3942855..3943529
Genome map
AA seq 224 aa AA seqDB search
MLFSQELWQRNLNLYQKILDLPFNQELANGTLDKEAFCHYVIQDAQYLVAYGRVLAVAAA
KAFDADDIMQFSDAAKIAIVVERSLHDDFMKNFGVTKEEFKNTPLTLAGHHYTSFLTATA
WSESYPVVLAALLPCFWIYAEVGKDIVSKSVPNNPYQAWIDTYAGEEFHTAVRNVIATVD
KVAARCDADTLEKMHAAYTMGAKLEWLFWDSAYHQRQWLGLDQI
NT seq 675 nt NT seq  +upstreamnt  +downstreamnt
atgcttttttctcaagaactctggcaacgtaatttaaatttatatcaaaaaattctcgac
ctgccttttaatcaggaacttgctaacggtactttagataaagaagctttttgtcattat
gttattcaagatgctcaatatttagtggcctatggccgtgtgctggctgttgcagcagct
aaagcttttgatgctgacgatattatgcagttttctgatgcagctaaaattgcaattgtg
gtcgagcgcagtttgcatgacgactttatgaaaaactttggtgtcaccaaagaagaattt
aaaaataccccattgaccttggcaggccatcattacacttcatttttgacagcaactgct
tggtctgaaagctaccctgttgtacttgctgctctattaccttgcttctggatttatgcc
gaagtcggtaaagacattgtgagtaagtctgtcccaaacaatccttatcaggcatggatt
gatacctacgcaggtgaagaattccataccgccgttcgtaatgtgattgcgacggtagat
aaagttgccgcacgttgtgatgcagatactttagagaaaatgcatgcagcctataccatg
ggtgcaaaacttgaatggttattttgggatagtgcctaccatcaaagacaatggttaggt
ttagatcagatctaa

DBGET integrated database retrieval system