KEGG   Trichophyton benhamiae: ARB_00588Help
Entry
ARB_00588         CDS       T01611                                 

Definition
(RefSeq) pyrroline-5-carboxylate reductase
  KO
K00286  pyrroline-5-carboxylate reductase [EC:1.5.1.2]
Organism
abe  Trichophyton benhamiae
Pathway
abe00330  Arginine and proline metabolism
abe01100  Metabolic pathways
abe01110  Biosynthesis of secondary metabolites
abe01130  Biosynthesis of antibiotics
abe01230  Biosynthesis of amino acids
Module
abe_M00015  Proline biosynthesis, glutamate => proline
Brite
KEGG Orthology (KO) [BR:abe00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00330 Arginine and proline metabolism
    ARB_00588
Enzymes [BR:abe01000]
 1. Oxidoreductases
  1.5  Acting on the CH-NH group of donors
   1.5.1  With NAD+ or NADP+ as acceptor
    1.5.1.2  pyrroline-5-carboxylate reductase
     ARB_00588
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: P5CR_dimer F420_oxidored
Motif
Other DBs
NCBI-GeneID: 9523123
NCBI-ProteinID: XP_003013043
UniProt: D4AWM2
AA seq 327 aa AA seqDB search
MHVPKKNKRANAANLASSITGTLGTSILSGVMASLSEPRSSSAYPPPSGSATPSEGLPVH
QIPSKFIACVRRPESVKRIQHILSPYNLPLTILQNENVKGVTDGDVIVLGCKPYMLSEVL
NVPGMREALKGKLLISILAGVPAEQIEEVLYKDSEIDMADRCRVVRAMPNTAAIVRESMT
VIASTNPPLSHFQSTIVSWIFTRVGRVITLPPHIMDASTALAGSGTAFVALVLEALADGA
VAMGLPRAESQLMAAQVMRGTAGMVLNGEHPALIREKTSTPGGCTIGGLLVLEEGRVRGA
IARSVREATVVASQLGKGVQGVNGTRF
NT seq 984 nt NT seq  +upstreamnt  +downstreamnt
atgcatgttccgaagaaaaacaaacgagcgaatgcggctaacttggcgtcgtcaatcaca
ggaacactcggtacctcgattctctccggcgtgatggcttctctctctgaaccgaggagc
tcgtcggcgtatcctccgccatccggctccgccaccccttctgagggcctgccggtgcac
cagatcccatccaagtttattgcctgtgtacggagaccggagtctgtcaagaggatccag
cacatcctcagcccgtacaacctccccttgaccatccttcaaaacgagaacgtcaagggt
gtgaccgacggtgatgtcatcgtgctcggctgcaagccatacatgctgagtgaagttctc
aatgtccccggcatgagagaagctctcaaaggcaagctgttgatcagcatcctcgccggt
gtgcctgcagagcagatcgaagaggtgctctacaaggattctgagatcgacatggccgac
agatgccgtgtcgttcgtgccatgcccaacactgctgcaattgtcagagagtcaatgact
gtcattgccagcaccaatccaccactatcccacttccagagcaccatcgtgtcatggatc
ttcactcgtgtgggccgtgtcatcacccttccaccacacatcatggacgcaagcactgct
ttggccggatccggcactgctttcgttgctcttgtgttggaagccttggctgatggagcc
gtcgccatgggtcttcccagggctgagtcgcagctgatggctgctcaggttatgcgtgga
accgctggaatggttctgaacggcgagcaccctgctttgattcgcgagaagactagcacc
cccggcggttgcactattggtggtcttcttgtccttgaagagggacgagtccgaggtgcc
atcgcacgctctgtcagagaggctactgtcgttgccagtcagcttggcaagggcgtccaa
ggtgttaacggaacacgattttaa

DBGET integrated database retrieval system