KEGG   Trichophyton benhamiae: ARB_01082Help
Entry
ARB_01082         CDS       T01611                                 

Definition
(RefSeq) hypothetical protein
  KO
K01958  pyruvate carboxylase [EC:6.4.1.1]
Organism
abe  Trichophyton benhamiae
Pathway
abe00020  Citrate cycle (TCA cycle)
abe00620  Pyruvate metabolism
abe01100  Metabolic pathways
abe01200  Carbon metabolism
abe01230  Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:abe00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    ARB_01082
   00620 Pyruvate metabolism
    ARB_01082
Enzymes [BR:abe01000]
 6. Ligases
  6.4  Forming carbon-carbon bonds
   6.4.1  Ligases that form carbon-carbon bonds (only sub-subclass identified to date)
    6.4.1.1  pyruvate carboxylase
     ARB_01082
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: CPSase_L_D2 PYC_OADA Biotin_carb_N Biotin_carb_C HMGL-like Biotin_lipoyl Biotin_lipoyl_2 Dala_Dala_lig_C ATP-grasp ATP-grasp_3 RimK HlyD_D23 ATP-grasp_4 DUF2118
Motif
Other DBs
NCBI-GeneID: 9522909
NCBI-ProteinID: XP_003012831
UniProt: D4AY13
AA seq 1232 aa AA seqDB search
MAPAPVPLPDVNSTAVREDAVEEDVMEDHHPSNFQDSVHSRLRANSSIMQFQKILVANRG
EIPIRIFRTAHELSLQTVAIFSYEDRLSMHRQKADEAYQIGKRGQYTPVAAYLAGQEIVN
IASQHGVHLIHPGYGFLSENAEFARAVEKAGMVFVGPTPETIDRLGDKVSARKIAIECKV
PVVPGTPGPVETFDAVKSFTDEYGFPIIIKAAFGGGGRGMRVVRDQESLRDSFERATSEA
KTAFGNGTVFVERFLDKPKHIEVQLLGDNHGNVVHLYERDCSVQRRHQKVVELAPAKDLP
IDVRDNILADAVRLAKHVNYRNAGTAEFLVDQQNRYYFIEINPRIQVEHTITEEITGIDI
VAAQIQIAAGATLEQLGLTQDRISIRGFAIQCRITTEDPTKGFQPDTGKIEVYRSAGGNG
VRLDGGNGFAGAIITPHYDSMLVKCTCHGSTYEVARRKMLRALVEFRIRGVKTNIPFLAS
LLTHPTFIDSQCWTTFIDDTPELFSLIGSQNRAQKLLAYLGDVAVNGSSIKGQVGEPKFK
GEILKPIMRDADGKPIDLSSPCKEGWKQIIDEKGPAAFAKAVRENKGCLIMDTTWRDAHQ
SLLATRVRTVDLVNIGKETSYAFRNAYSLECWGGATFDVSMRFLYEDPWDRLRKMRKVVP
NIPFQMLLRGANGVAYSSLPDNAIYHFCKQAKRYGVDIFRVFDALNDINQLEVGMKAVAA
AGGVIEATICYSGDMLNPKKKYNLDYYLGLVDKIVALGTHILCIKDMAGVLKPQAATLLV
GSIRKKYPDLPIHVHTHDSAGTGVASMVACAQAGADAVDAATDSMSGMTSQPSVGAILAS
LQGTDQDPKLDIPNVRAIDTYWAQLRLLYSPFEAGLSGPDPEVYEHEIPGGQLTNLIFQA
HQLGLGAQWLETKKAYEQANDLLGDIVKVTPTSKVVGDLAQFMVSNKLSPDDVIARAGEL
DFPASVLEFLEGLMGQPYGGFPEPLRSRALRDRRKLSDRPGLHLEPLDLAKIKAEIKEKF
GSATECDVASYAMYPKVYQDYRKFVAKYGDLSVLPTKYFLARPEIGEEFSVELEQGKVLI
LKLLAVGPLSEQTGQREVFYEMNGEVRQVTVDDVLATVDDTSRPKADPSDSSQVGAPMSG
VVVEIRAHEGVEVKKGDPIAVLSAMKMEMVISAPHHGKIASLHVKEGDSVDGQDLISKLK
SPSTCPTNDIAIVMDVCYQAVPIRDASKNVTS
NT seq 3699 nt NT seq  +upstreamnt  +downstreamnt
atggctccagcacctgtacctctgccagacgtcaatagtacggctgtccgcgaggacgcc
gtcgaggaagatgtcatggaagaccaccacccgtccaacttccaggattccgtccacagc
cgtctacgggccaattcctccatcatgcagttccagaagatcctcgtcgccaacagagga
gaaatccccatccgtatcttccgtacagcccacgaactctccctacaaactgttgctatc
ttcagctacgaggacagactgagcatgcatcgccaaaaggccgacgaggcgtatcagatc
ggtaagcgtggccagtacacgcccgtggctgcctacctggccggccaggagattgtcaac
attgcctcgcagcacggcgtccacctcattcacccgggatacggcttcttgtccgagaat
gccgagtttgctcgtgctgtcgagaaggccggtatggtcttcgtcggtcctactccagag
actatcgatagactcggtgataaggtctctgctcgaaaaatcgccatagagtgcaaggtc
cccgtcgtgcccggtacccccggcccggtcgagaccttcgatgctgtcaagtccttcacg
gatgagtacggcttccccatcatcatcaaggctgcctttggtggtggtggcagaggcatg
cgtgtcgtccgtgaccaggagtcgctgcgggactccttcgagcgtgctacctcggaggcc
aagactgctttcggcaatggcaccgtcttcgtagaacgcttcctcgataaaccaaagcac
atcgaagttcagcttcttggagacaaccacggcaacgtcgtccacctgtatgagcgtgac
tgcagtgtccaacgtcgtcatcagaaggtcgtcgagcttgctccggccaaggatctcccc
attgatgtccgtgacaacattcttgccgacgccgttaggctcgccaaacacgtaaactat
cgcaacgccggtaccgcggagttcctggtcgaccagcagaacagatactactttatcgaa
atcaacccccgtatccaggtcgagcacaccatcaccgaagaaatcacaggcatcgatatt
gtcgctgcccagatccagatcgccgccggtgctaccctagaacaactcggcctcacccaa
gaccgcatctccatcagaggtttcgccatccaatgccgtatcaccactgaggaccctacg
aagggcttccagccagatactggcaagatcgaggtctaccgctctgcaggtggtaacgga
gtccgtcttgatggcggtaacggctttgctggcgccatcatcaccccacattatgactcc
atgttggtcaaatgtacctgccatggttccacatacgaagtcgcacgccgaaagatgctt
cgtgccctcgttgagttccgtatccgtggcgtcaagacaaacattcccttcttggcttcg
ttgctaacacaccctaccttcatcgacagccagtgctggaccacctttattgatgatacc
ccagaactattctccctcattggctctcagaaccgtgcccagaaactccttgcgtacctt
ggtgatgttgcagtcaacggaagcagcatcaagggccaggttggcgaacccaagttcaag
ggcgaaatcttgaagcccatcatgcgtgatgcagatggcaaaccaatcgacctcagctct
ccctgcaaggagggatggaaacaaatcatcgatgaaaagggccccgctgcctttgcaaag
gctgttcgtgagaacaagggatgtcttatcatggacaccacttggcgtgatgcccatcag
tccctgctggcaactagagttcgtaccgttgacctcgtcaacatcggcaaagaaaccagt
tatgctttcagaaacgcatacagtttggagtgctggggtggtgctacctttgatgtctcc
atgagattcttgtacgaagatccatgggacagactcagaaagatgaggaaggttgttcca
aacatccccttccagatgctgcttcgtggcgccaacggcgttgcttactcttcccttcct
gacaatgccatctaccacttctgtaagcaggcaaagagatatggtgttgatatcttccgt
gtcttcgatgcccttaacgatatcaaccagcttgaagttggtatgaaggctgtagccgca
gcaggtggtgttattgaagctactatctgctactcgggagacatgcttaaccccaagaag
aagtacaacctggactactaccttggcttggtcgacaagattgtagccctgggaactcac
atcctttgtatcaaggatatggctggtgtcctcaagcctcaagctgccaccttgcttgtc
ggaagcatcaggaagaagtaccctgatctccccatccacgtccacactcacgactcagcc
ggtaccggtgttgcctccatggttgcctgtgcacaggcgggcgctgacgccgttgacgct
gcaaccgacagcatgtctggaatgacctctcagcccagtgtaggcgccatcctcgcctct
cttcagggcaccgaccaagaccccaagctcgacatccccaatgtccgtgccatcgacacc
tactgggcccagctccgtctcctctactcgcccttcgaggctggtctctctggacctgat
ccagaggtctacgagcacgaaatccccggtggccagcttaccaacctcatcttccaagct
caccagcttggtctcggtgctcaatggcttgagaccaagaaggcctatgagcaagccaac
gatctccttggagacattgtcaaggttacccctacctccaaggtcgtcggtgacctagct
cagttcatggtctccaacaagctaagcccagacgatgtgattgctcgcgccggtgagctt
gacttccccgcctccgtcctcgagttccttgagggtctcatgggccagccctatggcggg
ttccccgaacctctccgctccagggctcttcgtgatcgccgaaagctttcggaccgcccc
ggtctccacctagagcctcttgatctagctaagatcaaggccgagatcaaggagaaattc
ggcagcgctaccgaatgtgatgttgctagttacgcaatgtaccccaaggtctaccaagac
taccgcaaattcgtcgccaagtacggtgacctttctgtcctgccaaccaaatacttcctt
gccagacccgagatcggcgaagaattcagcgttgagctcgagcaaggaaaggtgctcatc
ctgaaactgctggctgtgggtcctctgtccgagcagacgggccagcgagaagtcttctat
gagatgaacggtgaagttagacaggtcactgttgatgacgttcttgctacggttgacgac
accagccgccccaaggccgatcccagtgacagcagccaggttggtgcaccaatgagtggt
gtagtagtcgaaatcagagcccacgagggtgtcgaggtgaagaagggagacccgattgct
gttcttagtgctatgaagatggaaatggtcatctctgcacctcatcacggaaagattgcc
agtctacatgtcaaggagggagattctgtcgatggacaggacctcatctcgaagcttaaa
tcaccatcaacttgcccaacgaatgatatcgctattgtcatggatgtttgctatcaagct
gtgccaatcagagatgcatccaagaatgtgacatcataa

DBGET integrated database retrieval system