KEGG   Trichophyton benhamiae: ARB_02387Help
Entry
ARB_02387         CDS       T01611                                 

Definition
(RefSeq) hypothetical protein
  KO
K01620  threonine aldolase [EC:4.1.2.48]
Organism
abe  Trichophyton benhamiae
Pathway
abe00260  Glycine, serine and threonine metabolism
abe01100  Metabolic pathways
abe01110  Biosynthesis of secondary metabolites
abe01130  Biosynthesis of antibiotics
abe01230  Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:abe00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    ARB_02387
Enzymes [BR:abe01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.2  Aldehyde-lyases
    4.1.2.48  low-specificity L-threonine aldolase
     ARB_02387
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Beta_elim_lyase
Motif
Other DBs
NCBI-GeneID: 9524230
NCBI-ProteinID: XP_003011329
UniProt: D4B1Q7
AA seq 346 aa AA seqDB search
MLEAITNTSLGDDVLQEDAVTCSLEKSVAELTNHESALLVMSGTMGNQVAIRTHLTQPPY
AVLCDHRGHIINYEGGGVSTWTGAYVKGIVPKNGRYLTLEDIMPHAVLGNDIHGCPTRVI
SLENTLDGMIMPLDEMKRISEWAHANGLKVHLDGARLWEAVVAGAGSVSEFSSLADSVSL
CFSKGLGAPIGSVLAGSNEFIQKARWFRKTIGGGTRQSGIIAAAAQVALNETFGSGPNGK
GGKLLVSHEMARKIAKLWTEKGGKLKNPVETNMVWLDLESCKLSNEDWIEIGRQHGLKFL
GGRLVVHYQISEGAIAKLDKAMDSAISGNFTPAAKNEKNGQYCGQA
NT seq 1041 nt NT seq  +upstreamnt  +downstreamnt
atgttggaagctatcacaaacacatctctcggcgatgatgtgctgcaggaagatgccgtg
acttgctcgctggagaagtctgttgccgagttaacgaatcatgaaagtgctctgctggtg
atgtctggaaccatggggaaccaggtggctatccgaactcatctgacacagccgccgtac
gcagttctgtgcgaccaccgcggccacatcattaactatgaaggaggaggtgtgtcaacc
tggaccggagcctatgtcaagggaattgtgcccaaaaatggaaggtatctcactctggaa
gatatcatgccccatgccgtactgggtaacgatatacatggctgtccgacacgggtgatc
agccttgaaaataccctggatggcatgataatgccgcttgatgagatgaaacggatttct
gagtgggcacatgcaaatgggctgaaagtgcaccttgatggagctaggctgtgggaagcc
gttgttgctggagctggaagtgtttctgagttcagttctttggcagacagtgtcagtctt
tgcttctcgaagggtcttggtgctccaattgggagtgtcctcgctgggtcgaacgagttc
atccaaaaagcccgctggttcaggaagacgattggcggagggactagacagtccggtatt
atcgctgccgcagcacaagttgctctcaatgaaacatttggcagtgggccaaatggcaaa
ggtggaaagctacttgtaagccacgaaatggctagaaagattgcaaagttatggaccgag
aagggcggaaagctcaaaaacccagtggaaaccaacatggtgtggcttgatctcgagtca
tgcaagttgtcaaacgaagactggattgagatcggccgacagcatggcttgaagtttcta
ggcggccggcttgtggtacactaccagataagcgagggggctattgcgaagttggacaag
gctatggactctgcaattagcggtaacttcactccggctgctaagaatgaaaagaatgga
caatattgcggccaggcataa

DBGET integrated database retrieval system