KEGG   Trichophyton benhamiae: ARB_03793Help
Entry
ARB_03793         CDS       T01611                                 

Definition
(RefSeq) hypothetical protein
  KO
K01733  threonine synthase [EC:4.2.3.1]
Organism
abe  Trichophyton benhamiae
Pathway
abe00260  Glycine, serine and threonine metabolism
abe00750  Vitamin B6 metabolism
abe01100  Metabolic pathways
abe01110  Biosynthesis of secondary metabolites
abe01230  Biosynthesis of amino acids
Module
abe_M00018  Threonine biosynthesis, aspartate => homoserine => threonine
Brite
KEGG Orthology (KO) [BR:abe00001]
 Metabolism
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    ARB_03793
  Metabolism of cofactors and vitamins
   00750 Vitamin B6 metabolism
    ARB_03793
Enzymes [BR:abe01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.3  Acting on phosphates
    4.2.3.1  threonine synthase
     ARB_03793
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Thr_synth_N PALP
Motif
Other DBs
NCBI-GeneID: 9525346
NCBI-ProteinID: XP_003009995
UniProt: D4B5N4
AA seq 544 aa AA seqDB search
MAATASQKYLSSRGGSYGFSFEEVVLKGLASDGGLFIPEQIPSLPTDWETKWRNYSFQEL
AFEILSLYISPSEVPSDDLKDIISRSYGTFSGYLADANGLNRSPDITPLVTLDEQKRLYL
LELFCGPTFAFKDVALQFLGNLFEYFLVRRNEGKSGKDRHHLVVIGATSGDTGSAAIYGL
RGKKDASVFILHPKGKVSPIQEAQMTTVLDENVHNISIEGSFDDCQDMVKALFADPEINK
THKLAAVNSINWARILAQITYYFHSYFSLIRSPTYVNGKPIRFVVPSGNFGDILAGWFGK
QMGLPVDKLVIATNENDILDRFLKTGQYTKQAQPEAQASASAVKETWSPAMDILVSSNFE
RLLWFLAYKVYGQGDIDEKRKIAGNTVLSWLQDLSGKGGFGVDEKILQAAQQEFESERVS
NEQTIDTIRSIYSTCFPQTPVSAGTRGETGGYILDPHSAIGVAASLRSISRCAETFHISL
STAHPAKFAEAVDAALRNEKGYSFDNVLPPEFVGLEKKERRVISMPAGATWKSVGEVINQ
NVAV
NT seq 1635 nt NT seq  +upstreamnt  +downstreamnt
atggctgctacggcgtcgcagaagtacttgagctctcggggtggctcgtacgggttttcc
tttgaagaagtcgtcctgaagggactggcatcagacggaggcctctttatcccggaacag
atcccttcgctgccgacggactgggagacaaagtggcgcaactatagcttccaggagctg
gcctttgagatcctatcattgtacatctccccttcagaggttccatcagatgacttgaag
gacataatatctcgcagctacgggacattcagtggctatcttgctgatgcgaatgggttg
aacaggtctcccgatatcaccccactggtcacattggacgagcagaagcgattatatctt
ttggagctgttctgcgggcctacatttgcctttaaagatgtggcattgcaattcttggga
aacctatttgaatacttcctcgtgagacggaatgagggcaagtccggcaaggaccgtcac
catcttgtggttattggagctacgagtggagacaccggctcagctgccatatatgggcta
cgtgggaagaaggacgcctccgtcttcatcctgcatccaaagggcaaagtgtctccaatc
caggaagctcagatgacaactgtgttagatgaaaatgtccataacatcagtattgaagga
tctttcgacgattgtcaggatatggttaaggctctttttgccgaccctgaaatcaacaaa
acccacaagctagctgctgtgaactcgataaattgggcccgaattcttgctcaaatcact
tactacttccattcttatttctccctcattcgatctcccacctacgtcaatggaaagcct
attcgatttgtcgtgccatcaggtaactttggagatatactggctggctggtttggaaag
caaatgggcctgccagtcgataaactggttattgccaccaacgagaatgacatccttgac
aggttcttgaaaactggccagtacacgaaacaagcacagcctgaggcgcaagccagcgca
tctgctgtaaaagaaacttggagtcctgctatggacattctggtatcaagcaattttgag
cggcttctctggttccttgcttacaaagtatacggtcaaggagatatcgacgagaagcgg
aaaatcgctggcaatacagttctcagctggcttcaggatctctctggcaagggaggattt
ggagttgatgagaagatactccaggcagctcagcaagagttcgagagtgagcgggtatct
aatgagcaaacgatcgacactattcgatccatttactcgacttgcttcccacaaacccct
gtcagcgctggcaccagaggagaaacggggggatacatccttgacccccattccgcgatt
ggagttgcagcatcgttgagatcgatatctcggtgcgcagagacctttcacatatcattg
tcgaccgcacatccagccaaatttgctgaagcggtggatgcggctctgcgaaacgaaaag
gggtattcgtttgacaacgtgcttcctccagagttcgttggcctagagaagaaggaacga
cgtgttatttccatgccggctggtgctacttggaaatcggttggcgaagtcatcaaccag
aacgttgctgtttag

DBGET integrated database retrieval system