KEGG   Trichophyton benhamiae: ARB_03894Help
Entry
ARB_03894         CDS       T01611                                 

Definition
(RefSeq) hypothetical protein
  KO
K12818  ATP-dependent RNA helicase DHX8/PRP22 [EC:3.6.4.13]
Organism
abe  Trichophyton benhamiae
Pathway
abe03040  Spliceosome
Brite
KEGG Orthology (KO) [BR:abe00001]
 09120 Genetic Information Processing
  09121 Transcription
   03040 Spliceosome
    ARB_03894
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03041 Spliceosome [BR:abe03041]
    ARB_03894
Enzymes [BR:abe01000]
 3. Hydrolases
  3.6  Acting on acid anhydrides
   3.6.4  Acting on acid anhydrides to facilitate cellular and subcellular movement
    3.6.4.13  RNA helicase
     ARB_03894
Spliceosome [BR:abe03041]
 Complex C
  Other components
   Step II factors
    ARB_03894
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: HA2 OB_NTP_bind Helicase_C S1 DEAD T2SSE AAA_22 AAA_16 AAA_33
Motif
Other DBs
NCBI-GeneID: 9525313
NCBI-ProteinID: XP_003009968
UniProt: D4B5Y7
AA seq 1214 aa AA seqDB search
MDDLESLELLSLVSRVTTELQNHLGVNEKTLAEFVIDQHLKCKSLDEFKSSLKAVGADFP
QSLVESVDRLVLTMHPKYKSKRTKPDEQEKQHIGQDGVDDIEKKARVFKGLAVPDDKAPH
WEEDEPEPERNTNAEAMDDTFAMLEGLAGKARAEQNGYSSSRKRSRSPEIDDYDRNRPRR
GRYRSRSRSRSGSPDRDRHGSRHSHRSRKYPDEPRERGRSGRNYNYDDDFKKPPASELDD
RPILFKIYDGRVTGIKDFGVFVNLQGVRGRVDGLVHVSAMQEGARVNHPSDLVSRGQQVK
VKVVSIQDSRIGLSMKEVDQVSGHDLAPQRRIASGANMERLDGTGADDRYGNLGSSVPVI
ERDSGTKRSKKRLNSPERWEIKQLIASGAVSAADYPDLDEEYHATLRGEGDFEEEEDIDI
EVREEEPPFLAGQTKQSLELSPIRVVRAPDGSLNRAAMAGANLAKERREIRQQEAQDKAA
EKAAQVDLNAQWQDPMVAPEQRKFASELRTATTEKSSEPLPEWKRAAQNKDVSYGKRTNL
SMKEQRESLPVFKFRKQLLEAVRENQLLIVVGDTGSGKTTQVTQYLAEGGFANNGMIGCT
QPRRVAAVSVAKRVSEEVGCQLGQEVGYTIRFEDCSSPNTKIKYMTDGILQREILLDPDL
KKYSAIMLDEAHERTIATDILFGLLKKTIKRRPDLKLIVTSATLDADKFSEYFNGCPIFS
IPGRTYPVEIMYSKEPESDYLDAALVTVMQIHLTEPPGDILLFLTGKEEIDTSAEILYER
MKALGPNVPELVILPVYSALPSEMQSRIFEPAPPGGRKVVIATNIAETSITIDQIYYVID
PGFVKQNAYDPKLGMDSLVITPISQAQAKQRAGRAGRTGPGKCFRLYTEAAYQSEMLPTS
IPDIQRQNLTQTILMLKAMGINDLLHFDFMDPPPTNTMLTALEELYALSALDDEGLLTRL
GRKMADFPMDPGLAKVLIASVDMGCSDEVLTIVAMLSVAQGIFYRPKEKQQQADQKKAKF
HDPHGDHLTLLNVYNAWKQSRFSTPWCFENFIQARQIRRAQDVRQQLVTIMDRYHHKIVS
CGRDTTRVRQAFCSGFFRNAARKDPQEGYKTLIEGTPVYMHPSSALFGKAAEHVIFDTLV
LTTKEYMQCATTIEPKWLVEAAPTFYKQASTNKLSKRKRAERIQPLHNKFAGEDDWRLSA
QRRQGRGGGGGTWG
NT seq 3645 nt NT seq  +upstreamnt  +downstreamnt
atggatgaccttgagtctctcgagctcttgtcactcgtttcgagggtaacgactgaacta
caaaatcatttaggagtcaacgaaaagacgctcgcggagttcgtgatcgaccagcatcta
aaatgcaagtctctcgacgaattcaagagctcgctcaaggctgttggagcggattttcct
cagagcttggtggaaagtgtggaccgcctagtcctaacaatgcatcctaaatataagtcg
aagcgaaccaaaccggatgaacaggaaaagcaacatattggacaagatggagttgatgac
atcgaaaagaaagcaagggtcttcaaagggcttgcggtcccagatgataaagctccccac
tgggaggaagatgagcctgagccggagcggaatacaaatgcagaggctatggatgacacg
ttcgcgatgctagaaggtttggctggcaaagctagagcagaacaaaatggttactcaagc
agtcgaaagcggagcagaagccctgaaattgacgattatgatagaaatcggcctcgccgt
gggaggtacaggtctagatccaggtcccggtctggatcacccgatagagatcggcatgga
agtaggcattctcacaggagccgcaaataccccgatgagcctagggagcgaggacgatct
gggcgcaattacaattatgatgatgattttaagaaaccacccgcatcagaactagatgat
cggcctattctcttcaaaatttatgatgggagagtgacgggtatcaaggacttcggtgta
tttgtgaatttgcaaggggtcagggggagagttgatggcttggttcatgtatctgcgatg
caagagggagcaagagtaaatcacccatctgatcttgtgtctcgcggacagcaagtcaag
gtcaaggttgtttctatccaggattcaaggatcggattatcgatgaaagaagttgaccag
gtttccggccacgacctggcaccccagaggcgaattgcgtcaggagcaaatatggaaaga
ttagatggaactggcgcagatgatcgatatggaaacctagggtccagcgtacccgttatc
gagcgggattccggtactaaaagaagcaagaaaagactaaactctccagagagatgggaa
attaaacagcttattgcctctggtgccgtgtctgctgcagactaccctgatttggatgag
gaatatcacgctacgctaagaggagagggagatttcgaagaagaggaggatattgatatt
gaggtgcgtgaggaagagcctccatttttggcgggtcaaaccaaacagtccttggaactt
tctccaattcgtgttgttcgagcaccggatggttcacttaaccgtgctgccatggctggc
gcaaatctcgcaaaggaaaggagagagattagacaacaagaagcccaagacaaggctgcg
gaaaaggcggctcaagtcgatcttaacgcacaatggcaggatccgatggttgcgccagag
cagaggaaattcgcgtcagagttacgcactgctaccactgaaaagtcatcagagcctttg
ccagagtggaaacgagcagcgcagaataaagatgtgtcatacggaaaaaggacaaatctt
tctatgaaagaacaacgcgaaagtcttcctgtgttcaaattccgcaaacaactactcgaa
gctgttcgggaaaatcagttacttatcgttgtcggcgacacggggtctggaaagacgacg
caggtcacccaatacctagcagagggaggatttgcaaataatggcatgattggatgcacg
caacctcggcgagtagccgcagtgtccgttgccaagcgagtatctgaagaagttggctgc
cagctgggccaggaagttggttatactatacgttttgaggattgctctagtcctaatact
aaaatcaagtacatgactgacggaattcttcaaagagaaatccttttggacccagacctg
aagaaatactctgccataatgcttgacgaggcccatgagagaactattgccactgacata
ctttttgggttgctcaagaaaactatcaagagacggcctgatcttaagctcattgtgaca
tcggctaccctcgatgcagacaaattctcggaatacttcaatggctgtcctatcttttct
ataccaggaaggacatatcccgtggaaataatgtactccaaggagcctgagtcagactac
ttggatgccgccttagttacagtgatgcaaattcatctcaccgaaccacccggggatatc
cttttgtttttaactggtaaggaggagattgacactagcgcagagatcttatatgagaga
atgaaagcgttaggtcccaacgtacccgaacttgttattcttcctgtttattccgctctt
ccaagcgaaatgcaaagcaggattttcgagccagcccctcccgggggaagaaaggttgtt
attgcaactaatatcgcggaaacgtcgattacaatagatcaaatatactacgttatcgat
cctgggtttgtcaaacaaaatgcctatgatccaaagctgggaatggactcgttagtgatc
acaccaatttcacaagctcaagccaaacaacgagctggtcgtgctggaagaacagggcct
ggtaaatgttttcgattatataccgaagctgcatatcaatctgagatgttgccgacatca
attccggatattcagcgtcaaaatcttacccaaactattcttatgctcaaagcaatggga
attaatgacctcctgcatttcgacttcatggaccctccccctaccaacaccatgctcact
gctcttgaggagttatatgcactctctgctcttgacgatgaggggcttttaactcgcctc
ggtcggaagatggctgatttccccatggatcccggcctggccaaggtccttattgcctcc
gtggatatgggttgctccgatgaagtcttgactattgttgctatgctctccgtggctcaa
ggtatcttctatcgacctaaagaaaaacaacagcaggcagatcagaagaaagctaaattt
catgaccctcatggcgaccaccttaccttgctaaatgtgtataacgcatggaaacagtca
cgattcagtaccccttggtgttttgaaaactttattcaagcgcgacaaatccgtcgagcc
caggatgtccgccaacaattggttaccattatggatcgataccaccataaaatcgtatcc
tgtggtagggatactacgagggttcgccaggcattttgttcaggctttttcagaaatgct
gctagaaaagatccacaggaaggatataagactttgattgaaggcaccccagtttacatg
caccctagctcagcactcttcgggaaagctgctgagcatgtcattttcgatacccttgtc
ctcacaacaaaagagtacatgcagtgtgccacgacaatagagccaaagtggcttgttgag
gcagcaccaacgttctacaagcaagcgagtaccaacaaattatcaaagaggaaaagagcg
gaacgcattcagccattacataacaaatttgcaggcgaagatgactggcgactatcagct
caaagacgacaaggtcgtggtggtggtgggggaacctggggatga

DBGET integrated database retrieval system