KEGG   Trichophyton benhamiae: ARB_04804Help
Entry
ARB_04804         CDS       T01611                                 

Definition
(RefSeq) tryptophan synthase
  KO
K01694  tryptophan synthase [EC:4.2.1.20]
Organism
abe  Trichophyton benhamiae
Pathway
abe00260  Glycine, serine and threonine metabolism
abe00400  Phenylalanine, tyrosine and tryptophan biosynthesis
abe01100  Metabolic pathways
abe01110  Biosynthesis of secondary metabolites
abe01130  Biosynthesis of antibiotics
abe01230  Biosynthesis of amino acids
Module
abe_M00023  Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:abe00001]
 Metabolism
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    ARB_04804
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    ARB_04804
Enzymes [BR:abe01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.20  tryptophan synthase
     ARB_04804
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Trp_syntA PALP
Motif
Other DBs
NCBI-GeneID: 9521997
NCBI-ProteinID: XP_003016515
UniProt: D4AMB4
AA seq 693 aa AA seqDB search
MEQIKETFRRCKEEKRSALVAYVTAGYPEASETVDIILAMEDGGADIIELGVPFTDPIAD
GPTIQRANTQALKNGVTVTSVLEMVRTARRKGLKAPVMMMGYYNPLLQYGEERMLKDAKA
AGVNGFIMVDLPPEEAVRFRDLCKKEGLSYVPLIAPATSEARMKLLCGIADSFIYVVSRM
GVTGATGTLSSGLPELLKRVHTYSGNVPAALGFGVSTREHFLEVQGIAEGVVIGSQMVTV
LGDAAPGERAQKIREYCSSITGRTVQRGPIPEVADEPGLADQLEALNTTKNPAAIPAQFG
EFGGQFVPESLMDCLAELEAGFNEAKNDPKFWEEYRSYYPYMSRPSSLHLAERLTEHAGG
ANIYLKREDLNHTGSHKINNALGQVLLARRLGKKRIIAETGAGQHGVATATVCAKFGMEC
VIYMGAEDVRRQALNVFRIKLLGASVIPVEAGSRTLRDAVNEALRAWVVHLDTTHYVIGS
AIGAHPFPTIVRTFQSVIGEETKAQMKELTGRLPDAVVACVGGGSNAVGMFYPFSNDPSV
KLLGVEAGGDGVDTARHSATLTGGSKGVLHGVRTYVLQNEHGQISDTHSISAGLDYPGVG
PELSNWKDSARAKFIAATDAQALIGFKTISQLEGIIPALESSHAVYGAIELAKTMKKGEN
IVLNLSGRGDKDVQSVADALPELGPKIGWDLRF
NT seq 2082 nt NT seq  +upstreamnt  +downstreamnt
atggagcaaataaaggagacatttcggcgatgcaaggaggagaaaagatctgctctcgtg
gcgtatgtcacagcggggtaccctgaggccagcgagacggtcgatatcatccttgccatg
gaagatggaggtgcagacattatcgaacttggagtcccattcacagacccgattgccgat
ggtcctaccatccagcgcgcaaacactcaggcgcttaagaatggagtcaccgttacttct
gttcttgagatggttagaactgctaggaggaagggactcaaggcccctgtgatgatgatg
ggatactacaaccccttgctacagtatggtgaagagagaatgttgaaggatgccaaagcc
gcaggagtcaacggctttatcatggttgacttgccgccagaagaagccgttcggttcaga
gatttgtgcaaaaaagaagggctctcttatgtcccgctgattgcgccggctacttccgag
gcccgtatgaaacttctctgcggaattgccgactccttcatctatgtcgtctctagaatg
ggtgttactggtgctaccggaacattgagctctggattacccgaacttttgaagcgagtg
cacacatattccggaaacgtccctgctgcgctgggattcggcgttagcaccagggagcac
ttcctagaagtccagggtatcgctgagggtgttgttatcggtagtcagatggtgactgtc
ctaggcgacgctgctccaggagagcgtgcccagaagatccgcgaatactgttcgagcatc
acaggtcgaactgtccaacgcgggcctatccccgaggtagccgacgagccaggccttgca
gaccagctcgaggctcttaacaccaccaagaaccctgcagctatccctgcacaattcggc
gaatttggaggccagtttgttcccgagtcattgatggattgcctcgctgagctggaggct
ggattcaacgaggccaagaatgaccccaaattctgggaagagtaccgctcttactaccca
tatatgagccgtccaagtagtcttcatcttgccgagcgcctgactgaacatgctggtgga
gctaacatctatctcaagcgagaagatcttaaccacaccggcagtcacaaaatcaacaac
gccctaggccaagtccttcttgcccgtcgccttggaaagaagagaattattgctgaaact
ggtgccggtcagcatggtgtcgctaccgccactgtctgcgccaaattcggcatggagtgt
gtcatttacatgggagcagaggatgttcgtcgccaagctctgaatgtattcagaataaaa
ctccttggagcctccgttatccccgttgaggctggatcacgtaccctccgtgatgcggtc
aacgaagctttgcgcgcttgggttgtccatctcgacacaacgcactatgttatcggctca
gccatcggagctcatcctttcccaaccatcgtccgaactttccagtcagttatcggagaa
gaaaccaaagcccagatgaaagaactcactggccgcctgccagatgctgtcgttgcttgt
gttggcggtggaagcaatgcagtgggcatgttctaccccttttccaatgatcccagcgtc
aaactccttggcgtagaagccggtggtgacggagtcgacaccgcgcgtcactcagctacc
cttacagggggctcgaagggcgtgctccacggcgtccgaacatatgtccttcaaaacgaa
cacggccagatctcagacacccactccatttctgctggattggattaccccggtgttgga
ccggagttgagtaactggaaggattccgccagggctaagttcatcgctgccactgacgca
caggctttaattggattcaagaccatttcgcagctggagggtatcattccagcccttgag
tcttcgcatgctgtttacggcgcaattgagctggctaagacaatgaagaagggtgagaac
atcgtgctcaatttgagtggacgaggcgacaaggatgtgcagagtgttgctgatgctctt
cctgaacttggacccaaaattggctgggatttgagattctaa

DBGET integrated database retrieval system