KEGG   Trichophyton benhamiae: ARB_04961Help
Entry
ARB_04961         CDS       T01611                                 

Definition
(RefSeq) hypothetical protein
  KO
K14826  FK506-binding nuclear protein [EC:5.2.1.8]
Organism
abe  Trichophyton benhamiae
Brite
KEGG Orthology (KO) [BR:abe00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03009 Ribosome biogenesis [BR:abe03009]
    ARB_04961
Enzymes [BR:abe01000]
 5. Isomerases
  5.2  cis-trans-Isomerases
   5.2.1  cis-trans Isomerases (only sub-subclass identified to date)
    5.2.1.8  peptidylprolyl isomerase
     ARB_04961
Ribosome biogenesis [BR:abe03009]
 Eukaryotic type
  Pre-60S particles
   Other pre-60S particles
    ARB_04961
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: FKBP_C NPL
Motif
Other DBs
NCBI-GeneID: 9522154
NCBI-ProteinID: XP_003016669
UniProt: D4AKW5
AA seq 480 aa AA seqDB search
MSGTQPVALYAAKVPPGALVPAVPDAAAMFRVTMAAIDPDAVPEYEDEAQASKPPRATLK
IIRPPPGLDYDDDDDDEEDDEDEEDDESDDETNGGPSDPARKKKAMLEAALKDMDDGMDE
DDDDDEEGETDLAAAISKLVKGKGKAMEDEDDSDSDEDLELDEVVVCTLDPERNCQQTLD
FVVGEGERVFFKVTGTHTVYVTGNYVTPLENMYDSEDEDNDEDDEDDYDLSPDEDELAAL
VGDDDESDELDDMANPRVMEIDTDEEEEVKAQTQAKQSKKEKKGKKRPADDSDEEPNLDD
MISKTLKDEPATNGETKSSKKQMKKLKKNNGEAAEAEAAKANTKSDKKVQFAKDLEQGPT
PSKTTQTGTLGVKQVQGVTVDDKKLGTGKQVKKGDRIGMRYIGKLENGKVFDSNKSGKPF
TCKVGTGEVIKGWDIGIPGMAVGGERRLTIPAHLAYGKKSLPGIPANSKLIFDVKLLSIK
NT seq 1443 nt NT seq  +upstreamnt  +downstreamnt
atgtcaggaactcagccagttgctctctatgcggccaaggtgcctccaggcgcccttgtg
cctgctgtccctgatgccgccgccatgttccgtgtgaccatggccgcaattgatcccgac
gcggtgccggagtacgaggatgaggcccaggccagcaagcccccccgagctacgctgaag
atcatccgccctcctcctggtcttgattatgatgacgacgatgacgacgaggaggatgac
gaagatgaggaggatgatgagtccgacgatgagaccaatggcggcccgagtgacccggcc
agaaagaagaaggccatgcttgaagctgccttgaaggatatggatgacggcatggatgaa
gacgatgatgatgacgaggagggggagactgacctcgctgctgccatttctaaactagtt
aagggcaagggaaaggccatggaagatgaagatgatagtgacagcgacgaggatttggaa
ctcgacgaagttgtcgtctgcacacttgacccagagcgtaactgccagcagactttggac
tttgttgtaggtgaaggtgagcgtgtcttcttcaaggtcactgggactcacactgtctac
gtcactggaaactatgtgactcccctcgaaaacatgtatgacagtgaagacgaggacaat
gatgaggatgatgaggatgactacgacctctcacccgatgaagatgagctagctgccctc
gtgggtgatgatgatgagagtgacgagctagatgacatggccaatccaagagttatggag
atcgacaccgatgaggaggaggaggtcaaggctcagactcaggctaagcaatccaagaag
gagaagaagggcaagaagcgccccgcagatgattcagatgaggagccaaacttggatgac
atgatctccaagaccttgaaggacgagcctgcgacaaatggcgagactaagtcgagcaag
aaacaaatgaagaaactaaagaagaacaatggcgaagctgctgaggcagaggctgctaag
gccaacaccaagtctgacaagaaagtccagttcgcgaaggacctggaacaaggccctact
ccatccaagacaacccagactggcactcttggagtgaagcaagtacaaggggttactgtt
gacgacaagaagcttggaacaggcaagcaggttaagaagggtgatcgaattggcatgaga
tacatcggaaagctagagaatggcaaagttttcgactctaataaatccggaaagcctttc
acttgcaaggttggaacgggtgaagtaatcaagggctgggacattggtattcccggcatg
gctgtgggcggtgagcgaagactcactatcccagctcatcttgcctatggaaagaaatct
cttcctggaattcccgctaattccaaactcatcttcgacgttaagctcctgagcatcaaa
taa

DBGET integrated database retrieval system