KEGG   Trichophyton benhamiae: ARB_05372Help
Entry
ARB_05372         CDS       T01611                                 

Definition
(RefSeq) aldose 1-epimerase family protein, putative
  KO
K01785  aldose 1-epimerase [EC:5.1.3.3]
Organism
abe  Trichophyton benhamiae
Pathway
abe00010  Glycolysis / Gluconeogenesis
abe00052  Galactose metabolism
abe01100  Metabolic pathways
abe01110  Biosynthesis of secondary metabolites
abe01130  Biosynthesis of antibiotics
Module
abe_M00632  Galactose degradation, Leloir pathway, galactose => alpha-D-glucose-1P
Brite
KEGG Orthology (KO) [BR:abe00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    ARB_05372
   00052 Galactose metabolism
    ARB_05372
Enzymes [BR:abe01000]
 5. Isomerases
  5.1  Racemases and epimerases
   5.1.3  Acting on carbohydrates and derivatives
    5.1.3.3  aldose 1-epimerase
     ARB_05372
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Aldose_epim
Motif
Other DBs
NCBI-GeneID: 9523891
NCBI-ProteinID: XP_003015975
UniProt: D4AMB9
AA seq 440 aa AA seqDB search
MCGVLRQLMLLLLAFLSITPSCSAWNFHHQLNGTTPSNGTTTNGSSSCPLANGASSNPLQ
VYTIAANNITASFIPYGARLISLMVPDREGKMQDVIVGYDNPQDYVKDTLTNHTYFGCIV
GRYANRIRNGTFVLDGTTYNTPKNELNKTQTLHGGSVGYDQRNWTVTALSNSSITFTLFD
SGYEHFPGDVINHVTFSVNSSYGLKRPNPQTEFTARTVSLSLTEKTPIMLSPHIYWNLNA
FKNETVLEDTLLELPLSSRYVEVDSRLIPTGNIGNVSSSLNGTLDFTKGKLIGKDIKSAD
GICGANCTGYDNCFIIDRPNNASDWTSSPQTMVPAVNMSSITTGINMLVTTNQQAIQIYS
CNGQNGTIPVKGSQVARNKASGDGNGTVVDKIEQYGCLVIETEGWIDGINNPDWGQDPFQ
IYSPESGPAINWATYVFTAS
NT seq 1323 nt NT seq  +upstreamnt  +downstreamnt
atgtgcggtgtccttcgccaactcatgcttctgctgctagccttcctcagcataacaccc
agttgctcagcatggaacttccatcaccagttaaatggcactacaccttctaatgggacg
actacgaatggctcatctagctgccccctagccaatggagcgtcgtcgaatccactacaa
gtatacaccattgctgcaaataacattactgcatcgttcattccatacggtgcccgtcta
atctccctcatggtccccgatcgtgagggtaagatgcaggatgttatagttggctacgat
aacccccaggactatgttaaagacacactcactaaccatacgtactttgggtgcattgtc
ggacgatatgccaacaggattagaaatggtacatttgtcctagatggaactacatacaat
acaccaaaaaacgagctgaataaaactcagacattacacggtgggagtgttggttatgac
cagcgtaactggactgttacggctctgtcgaatagctccataaccttcaccttgttcgat
tccggctatgaacacttcccgggtgatgtcataaatcatgttactttcagtgttaattcg
tcatatggcttgaaaaggcccaatccacagacagagttcaccgcccgaaccgtttctctc
tctttgacagaaaagacgcccatcatgttgtcacctcatatatactggaatctcaacgct
tttaagaatgagaccgtgctagaggacacgctacttgaactaccactatctagtcgatac
gtggaggtggactcgcggcttatcccaaccggaaacataggaaatgtctcttcctccctc
aatggtaccctagacttcacaaaggggaagttgatcgggaaagatatcaagtccgcagat
ggaatctgtggagcaaattgtactgggtacgataactgcttcattattgataggcccaat
aatgcgtctgactggacttcttccccccaaacaatggtccctgctgtgaatatgtcctcg
atcactacgggtataaatatgctggtcacaacaaatcagcaggcgattcaaatatactcc
tgcaatggtcagaatggcacgatccctgtgaaaggctcacaagtggcaaggaataaggct
agcggggatgggaacggtacggttgtggataagatagaacagtatggctgccttgtcatt
gaaaccgaggggtggattgatggcatcaataacccagactggggtcaggatccgttccaa
atatattctcccgagtcaggtcctgcgataaactgggcaacgtatgtgtttactgcttcc
tga

DBGET integrated database retrieval system