KEGG   Trichophyton benhamiae: ARB_05648
Entry
ARB_05648         CDS       T01611                                 

Definition
(RefSeq) hypothetical protein
  KO
K00222  Delta14-sterol reductase [EC:1.3.1.70]
Organism
abe  Trichophyton benhamiae
Pathway
abe00100  Steroid biosynthesis
abe01100  Metabolic pathways
abe01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:abe00001]
 09100 Metabolism
  09103 Lipid metabolism
   00100 Steroid biosynthesis
    ARB_05648
Enzymes [BR:abe01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.1  With NAD+ or NADP+ as acceptor
    1.3.1.70  Delta14-sterol reductase
     ARB_05648
SSDB
Motif
Pfam: ERG4_ERG24 DUF1295
Other DBs
NCBI-GeneID: 9524321
NCBI-ProteinID: XP_003016250
UniProt: D4AN44
AA seq 363 aa
MLLGCAVGTWIYGAEFRLWTFLWENHLQVVTANLIICVSLAVFVYLRSFTVPAPGQHNPM
NRELAPGGQSGNIIYDYFIGRELNPRIILPIPFVSENSRTLDIKAFCEMRPGLLGWVIMN
LSNIAHQYRINSGNVTSSILLITAFQAWYVFDALYMEPAILTTIDIILDGFGFMLSFGDL
VWVPFIYSLQTRYLAMYPLQLSPINVALILGAQGVGYSIFRGANNQKNRFRTNPEDPRIK
HIQYIETRSGSRLMTSGWWGMARHINYLGDWIMAWTYCLPTGMAGFAMVESLNPITGMIE
KRAVQTEESRGWGMAITYFYVVYFGILLVHRERRDEDKCKRKYGEDWAKYTSRVKSRIIP
GIY
NT seq 1092 nt   +upstreamnt  +downstreamnt
atgctgctaggctgcgctgtgggaacctggatatatggcgctgaattccggctatggacc
ttcctctgggagaaccaccttcaagtggttacagccaaccttatcatctgtgtgtcacta
gctgtgtttgtttacctgaggagtttcacggtccctgctccagggcaacataatcctatg
aaccgcgagttggctcctggaggacaaagcggtaacatcatatacgattatttcattggg
cgcgagctcaatccaagaattatcctccccattccatttgttagtgaaaactccaggacc
cttgatataaaggcattttgtgagatgcgccctggactccttggatgggttatcatgaat
ctttcaaacattgcacaccagtacagaataaattctggcaacgtgacttcatcaatactt
ctcatcaccgctttccaggcctggtatgtgtttgatgcactctacatggaaccagctatt
cttacaaccatcgacatcattctggatggattcggttttatgctgtctttcggcgacttg
gtatgggttccattcatctattctctgcagacaagatacctcgctatgtaccctcttcaa
ttgagccccatcaatgttgcattgatacttggtgcgcagggtgttggatactctattttc
cgtggggccaataaccagaagaatagattcaggacaaacccggaggatccacgaatcaaa
catatccaatacatcgagactcgcagtggatcaagactgatgacttctggatggtggggt
atggctcgccatattaactatctcggagactggatcatggcttggacttactgcctcccg
actggcatggccggatttgctatggtggaatctctgaaccctattacaggtatgatagag
aagcgtgctgttcagacagaagagtcgcgcgggtggggaatggccatcacctacttctac
gttgtttacttcggaatccttctcgtccatagagagcgacgtgatgaagacaaatgcaaa
agaaaatacggtgaagactgggctaaatatacttccagggttaagagccgaatcattcca
ggaatctactaa

DBGET integrated database retrieval system