KEGG   Azospirillum brasilense Sp7: AMK58_07785Help
Entry
AMK58_07785       CDS       T04566                                 

Definition
(GenBank) methionine--tRNA ligase
  KO
K01874  methionyl-tRNA synthetase [EC:6.1.1.10]
Organism
abf  Azospirillum brasilense Sp7
Pathway
abf00450  Selenocompound metabolism
abf00970  Aminoacyl-tRNA biosynthesis
abf01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:abf00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00450 Selenocompound metabolism
    AMK58_07785
 09120 Genetic Information Processing
  09122 Translation
   00970 Aminoacyl-tRNA biosynthesis
    AMK58_07785
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01007 Amino acid related enzymes [BR:abf01007]
    AMK58_07785
  09182 Protein families: genetic information processing
   03016 Transfer RNA biogenesis [BR:abf03016]
    AMK58_07785
Enzymes [BR:abf01000]
 6. Ligases
  6.1  Forming carbon-oxygen bonds
   6.1.1  Ligases forming aminoacyl-tRNA and related compounds
    6.1.1.10  methionine---tRNA ligase
     AMK58_07785
Amino acid related enzymes [BR:abf01007]
 Aminoacyl-tRNA synthetase
  Class I (U)
   AMK58_07785
Transfer RNA biogenesis [BR:abf03016]
 Eukaryotic type
  Aminoacyl-tRNA synthetases (AARSs)
   Multi-aminoacyl-tRNA synthetase complex (MSC)
    AMK58_07785
 Prokaryotic type
   Other AARSs
    AMK58_07785
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: tRNA-synt_1g tRNA-synt_1 tRNA-synt_1e Anticodon_1 tRNA-synt_1f
Motif
Other DBs
NCBI-ProteinID: ALJ35336
UniProt: A0A0P0EST9
Position
1687107..1688657
Genome map
AA seq 516 aa AA seqDB search
MTGSKTFYLTTPIYYVNDVPHIGHAYTTLACDVLARFMRLDGYDVKFLTGTDEHGQKVEK
SAMNAGIAPQEFTDRVSKNFRDLVSLMNFSNDDFIRTTEPRHIASVQELWRRLESAGEIY
LGSYAGWYSVRDEAFYGEDELTTSPSGKKIAPTGAECEWVEEPSYFFRLSAWQDRLLEFY
EQNPDFIAPAGKRNEVMAFVKSGLKDLSVSRTTFKWGIPVPGNPDHIMYVWLDALANYIT
AVGFPDESGEYAKYWPANLHMVGKDILRFHAVYWPAFLMAAKLAPPKRVFAHGWWTIEGQ
KMSKSLGNVIAPETLVNTYGLDQTRYFLLREVPFGNDGDFSHKQMVQRINGNLANDYGNL
VQRSLSMIGKNCGAAVPQPGAFTEADDALLGAARNLLPIVRAEIRSQSFHKALDAIWAVI
GDGNRYVDEQAPWALKKTDPARMATVLYVLAETIRHLAILTQPIMPEASAKILDQLAQGP
EARGFDRLGAGGALVAGTPLPTPQGVFPRYVDEAKS
NT seq 1551 nt NT seq  +upstreamnt  +downstreamnt
atgaccgggtcgaagaccttctacctgacgactccgatctattacgtgaacgacgtgccg
cacatcgggcacgcgtacaccacgctcgcctgcgacgtgctggcccgcttcatgcggctg
gacggctatgacgtgaagttcctcaccggcaccgacgagcacggccagaaggtggagaaa
tccgccatgaacgccggcatcgcgccgcaggagttcaccgatcgcgtgtcgaagaacttc
cgcgacctcgtctcgctgatgaacttctccaacgacgacttcatccgcacgaccgagccg
cggcacatcgcatcggtgcaggaactgtggcgccgtctggaatcggccggcgagatttat
ctcggcagctacgccggctggtactcggtgcgcgacgaggccttctacggcgaggatgag
ctgaccacgtcgccgtccggcaagaagatcgccccgaccggcgccgagtgcgagtgggtg
gaggagccgtcctacttcttccgcctgtcggcttggcaggaccgcctgctggagttctac
gagcagaatccggatttcattgcccctgccggcaagcgcaacgaggtgatggccttcgtg
aagtcggggctgaaggacctgtcggtcagccgcaccaccttcaagtggggcatccccgtg
ccgggcaaccccgaccacatcatgtatgtctggctggacgccctggccaactacatcacc
gcggtcggtttcccggacgagagcggcgagtacgccaaatactggccggccaacctgcac
atggtcggcaaggacatcctgcgcttccacgccgtctattggccggccttcctgatggcc
gccaagctggccccgcccaagcgcgtcttcgcccatggctggtggaccatcgaaggccag
aagatgtcgaagtcgctgggcaacgtcatcgcgccggagacgctggtcaacacctacggc
ctggaccagacccgctacttcctgctgcgcgaggtgcccttcggcaacgacggcgacttc
tcgcacaagcagatggtgcagcggatcaacggcaacctcgccaacgattacgggaacctc
gtgcagcgctcactgtcgatgatcggcaagaactgcggggccgccgtgccgcagccgggc
gccttcaccgaggccgacgacgccctgctcggcgccgcccgcaacctgctgccgatcgtc
cgggcggagatccggtcgcagtccttccacaaggcgctggacgccatctgggcggtgatc
ggcgacggcaaccgttatgtggacgaacaggccccctgggcgctgaagaagaccgatccg
gcgcgcatggccacggtgctgtacgtgctggccgagaccatccgccatctcgcgatcctg
acccagccgatcatgccggaagcctcggcgaagatcctggaccagctggcgcaggggccg
gaagcccgcgggttcgaccggctgggggcgggtggggcactggtcgccggcacgccgctg
cccacgccgcagggcgtgttcccccgctatgtggacgaagcgaagagctga

DBGET integrated database retrieval system