KEGG   Azospirillum brasilense Sp7: AMK58_22015Help
Entry
AMK58_22015       CDS       T04566                                 

Definition
(GenBank) NAD-dependent epimerase
  KO
K12454  CDP-paratose 2-epimerase [EC:5.1.3.10]
Organism
abf  Azospirillum brasilense Sp7
Pathway
abf00520  Amino sugar and nucleotide sugar metabolism
abf01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:abf00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00520 Amino sugar and nucleotide sugar metabolism
    AMK58_22015
Enzymes [BR:abf01000]
 5. Isomerases
  5.1  Racemases and epimerases
   5.1.3  Acting on carbohydrates and derivatives
    5.1.3.10  CDP-paratose 2-epimerase
     AMK58_22015
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Epimerase GDP_Man_Dehyd NAD_binding_4 3Beta_HSD RmlD_sub_bind Polysacc_synt_2 adh_short
Motif
Other DBs
NCBI-ProteinID: ALJ38202
UniProt: A0A0P0FD88
Position
ABSP7_p2:93523..94602
Genome map
AA seq 359 aa AA seqDB search
MSVALVTGSCGLIGSESCLHFGALGMDVVGIDNDMRRTFFGDEASTAWQRQTLEQTLRQR
YRHHAIDIRDAAAIDALFERHGSSISLIIHTAAQPSHDWAARDPQMDFSVNANGTLNLLE
AARRHCPDAVFIFTSTNKVYGDTPNRLPLIETETRYEIDPAHRYAGGIAEDMSIDATLHS
LFGASKVAADVLVQEYGRYFGMRTVCFRGGCLTGPNHSPTQLHGFLAYLMRCAVTGTRYD
VIGYKGKQVRDNIHSNDLIAAFHAVYDAPRSAEVYNIGGGRASNCSILEAVALCEEITGR
PMDLAFKEANRIGDHIWWVSSLDRFRSHYPSWDIRHDVRNILTDIHDSNRRRWRVEAVA
NT seq 1080 nt NT seq  +upstreamnt  +downstreamnt
atgtccgtcgcccttgtcaccggttcctgcggattgatcgggtcggagagttgcctgcat
ttcggtgcgctgggaatggacgtcgtcggcatcgacaacgacatgcggcggaccttcttc
ggcgacgaggcctcgaccgcgtggcagcgccagaccctggagcagacgctgcgccagcgc
taccgccaccacgccatcgacatccgcgacgccgcggccatcgacgcgctgttcgagcgg
cacggctccagcatctccctgatcatccatacggcggcgcaaccgtcgcacgattgggcg
gcgcgcgacccgcagatggatttctcggtgaacgccaacggcacgctgaacctgctggag
gcggcgcggcggcattgcccggacgcggtgttcatcttcacctcgaccaacaaggtctac
ggcgacacgccgaaccgcctcccgctgatcgagacggaaacgcgctacgagatcgacccg
gcgcaccgctacgccggcggcatcgccgaggacatgtcgatcgacgccaccctgcacagc
ctgttcggtgcctccaaggtggccgccgacgtgctggtccaggaatacggccgctatttc
ggcatgaggacggtgtgcttccgcggcggctgcctgaccgggccgaaccattcgccgacg
cagcttcacggcttcctggcctacctgatgcgctgcgccgtcaccggcacccgctacgac
gtgatcggctacaagggcaagcaggtccgcgacaacatccacagcaacgacctgatcgcc
gccttccacgccgtctacgacgcgccgcgcagcgccgaggtctacaacatcggcggcggg
cgggcgagcaactgctccatcctggaggcggtggcgctgtgcgaggagatcaccgggcgt
ccgatggatctggcgttcaaggaggccaaccgcatcggcgaccacatctggtgggtcagc
tcgctcgaccggttccgctcccattacccgtcctgggacatccggcacgacgtgcggaac
atcctcaccgacattcacgacagcaatcggcgccgctggcgcgtggaggccgtggcatga

DBGET integrated database retrieval system