KEGG   Azospirillum brasilense Sp7: AMK58_23235Help
Entry
AMK58_23235       CDS       T04566                                 

Definition
(GenBank) acetyl-CoA acetyltransferase
  KO
K00626  acetyl-CoA C-acetyltransferase [EC:2.3.1.9]
Organism
abf  Azospirillum brasilense Sp7
Pathway
abf00071  Fatty acid degradation
abf00072  Synthesis and degradation of ketone bodies
abf00280  Valine, leucine and isoleucine degradation
abf00310  Lysine degradation
abf00362  Benzoate degradation
abf00380  Tryptophan metabolism
abf00620  Pyruvate metabolism
abf00630  Glyoxylate and dicarboxylate metabolism
abf00640  Propanoate metabolism
abf00650  Butanoate metabolism
abf00900  Terpenoid backbone biosynthesis
abf01100  Metabolic pathways
abf01110  Biosynthesis of secondary metabolites
abf01120  Microbial metabolism in diverse environments
abf01130  Biosynthesis of antibiotics
abf01200  Carbon metabolism
abf01212  Fatty acid metabolism
abf02020  Two-component system
Brite
KEGG Orthology (KO) [BR:abf00001]
 Metabolism
  Carbohydrate metabolism
   00620 Pyruvate metabolism
    AMK58_23235
   00630 Glyoxylate and dicarboxylate metabolism
    AMK58_23235
   00640 Propanoate metabolism
    AMK58_23235
   00650 Butanoate metabolism
    AMK58_23235
  Lipid metabolism
   00071 Fatty acid degradation
    AMK58_23235
   00072 Synthesis and degradation of ketone bodies
    AMK58_23235
  Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    AMK58_23235
   00310 Lysine degradation
    AMK58_23235
   00380 Tryptophan metabolism
    AMK58_23235
  Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    AMK58_23235
  Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    AMK58_23235
 Environmental Information Processing
  Signal transduction
   02020 Two-component system
    AMK58_23235
Enzymes [BR:abf01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.9  acetyl-CoA C-acetyltransferase
     AMK58_23235
Exosome [BR:abf04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   AMK58_23235
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Thiolase_N Thiolase_C ketoacyl-synt ACP_syn_III_C DUF5417
Motif
Other DBs
NCBI-ProteinID: ALJ38414
UniProt: A0A0P0EQR6
Position
ABSP7_p2:409927..411108
Genome map
AA seq 393 aa AA seqDB search
MTDTVVIAGAARTPMGGFQGDLQGLTAPQLGSAAIKAALERAGVKPDAVDEVFMGNVLPA
GLGQAPARQASLGAGIPEAAGCTTISKVCGSGMKAVMLATDLIKAGSAEIMVAGGMESMS
NAPYLLDRARGGYRMGHGRVLDHMFLDGLEDAYDRGRLMGTFAEECATHYQFTREAQDNY
AIESLNRARRATEDGSFVKEITAVTVKGRKGDTVVEKDEQPLKADPAKIPTLKPAFAKDG
TVTAANASSISDGAAALVLTTRSNAEKLGLPILAEIKAHANHAQAPAWFTTAPVGAINKV
LERAGWSAKDVDLYELNEAFAVVAMAAMRELDIPHDKINVHGGACALGHPIGASGARILV
TLLAALEKNGLKRGVASLCIGGGEATAVAVELV
NT seq 1182 nt NT seq  +upstreamnt  +downstreamnt
atgaccgataccgttgtgatcgcgggcgccgcccgcacgccgatgggcggcttccagggc
gacttgcaggggctgaccgcaccgcagctcggctccgccgccatcaaggccgcgctggag
cgcgccggggtgaagccggatgccgtggacgaggtgttcatgggcaacgttctgcccgcc
gggctggggcaggcgccggcgcgacaggcgtcgctcggcgccggcatcccggaggctgcc
ggctgcacgaccatctccaaggtctgcgggtcgggcatgaaggcggtgatgctcgccacc
gacctcatcaaggccggctcggcggagatcatggtcgccggcggcatggagagcatgtcc
aacgctccctacctgctggaccgcgcgcgcggcggctaccgcatgggccacggccgcgtg
ctcgaccacatgttcctcgacgggctggaggacgcctacgaccgcgggcgcctgatgggc
accttcgcggaggaatgcgccacccactaccagttcacccgcgaggcgcaggacaactac
gccatcgagagcctgaaccgcgcccgccgcgccaccgaggacggcagcttcgtcaaggag
atcaccgcggtcaccgttaagggccgcaagggcgacacggtggtggagaaggacgagcag
ccgctgaaggccgacccggccaagatccccacgctgaagcccgccttcgccaaggacggc
acggtgacggcggccaacgcctcctccatctcggatggtgcggcagcgctggtgctgacc
acccggtcgaacgcggagaagctcggcctgccgatcctggcggagatcaaggcccacgcc
aaccacgcccaggccccggcctggttcaccaccgccccggtcggtgcgatcaacaaggtg
ctggagcgcgccggctggtcggccaaggacgtggacctctacgagctgaacgaggccttc
gccgtggtcgccatggcggcgatgcgcgaactcgacatcccgcatgacaagatcaacgtg
catggcggcgcctgcgcgctcggccatccgatcggcgcgtccggcgcgcgcattctcgtc
acgctgctggcggccctggagaagaacgggctgaagcgcggtgtcgcctcgctgtgcatc
ggcggtggcgaggccacggcggtggcggtggagttggtgtaa

DBGET integrated database retrieval system